Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR1004 IGR1010 IGR1006 IGR1008 IGR1005 IGR1007 IGR1009 IGR1003 ilvI, - NG1236 NG1244 NG1237 hisB, - NG1242 hisG, - NG1238 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 ilvI, - NG1236 NG1244 NG1237 hisB, - NG1242 hisG, - NG1238 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 Type: tandem, Name:  - 58 ilvI, - NG1236 NG1244 NG1237 hisB, - NG1242 hisG, - NG1238 NG1245 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240
* Calculated from Protein Sequence

Gene ID: NG1240

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hisD  hisX  

Definition:
histidinol dehydrogenase

Gene Start:
1191352

Gene Stop:
1192638

Gene Length:
1287

Molecular Weight*:
46369

pI*:
5.00

Net Charge*:
-12.18

EC:
1.1.1.23  

Functional Class:
Amino acid biosynthesis; Histidine family  

Pathway: pathway table
Histidine metabolism

Secondary Evidence:
Jovanovic,G., Kostic,T. and Savic,D.J.
Nucleotide and amino acid polymorphism in the gene for L-histidinol dehydrogenase of Escherichia coli K12
Nucleic Acids Res. 18 (12), 3634 (1990)
M:90301483


Comment:
Oklahoma ID: NGO.1240

For other 'his' genes, see NG0210 (hisI), NG0211 (hisF), NG0212 (hisA), NG0213 (hisH), NG0397 (HisZ), NG0426 (hisS), NG1152 (hisJ), NG1238 (hisG), NG0185 (his2), NG1241 (hisC), NG1242 (hisB).

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to histidinol dehydrogenase sequences, e.g. residues 1-428 are 63% similar to the enzyme from P.aeruginosa (gb|AAG07836).

Residues 1-429 are virtually identical to NMB1581 in N.meningitidis (gb|AAF41934).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0141
COG name: Histidinol dehydrogenase
Functional Class:  E
The phylogenetic pattern of COG0141 is amt-yqvCebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001692 (Histidinol dehydrogenase) with a combined E-value of 5.6e-163.
    IPB001692A    33-58
    IPB001692B    80-102
    IPB001692C    123-163
    IPB001692D    184-221
    IPB001692E    230-272
    IPB001692F    345-389
    IPB001692G    392-427


ProDom Summary:  Protein Domain Search
Residues 28-427 are 51% similar to a (HISTIDINOL DEHYDROGENASE HISTIDINE) protein domain (PD002680) which is seen in HISX_AQUAE.



Paralogs:  Local Blast Search


NG1240 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 15 to 429 (E-value = 2.3e-195) place NG1240 in the Histidinol_dh family which is described as Histidinol dehydrogenase (PF00815)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
120  
237
transmembrane  
171  
187
transmembrane  
227  
243

PDB Hit:
pdb|1K75|1K75-A THE L-HISTIDINOL DEHYDROGENASE (HISD) STRUCTURE 301.0 2e-82

Gene Protein Sequence:
MKKLNTQSPDFQAGLKALLAFETAQNPETERIVADICADVQKRGDAALIE
YTNKFDQTNAKSIDDLILTQADLNAAFERIPNDVQTALQTAARRVESYHQ
RQKMESWSYTDEDGTLLGQQITPLDRVGIYVPGGKAAYPSSVIMNAMPAH
VAGVKEIIMVVPTPKGERNDIVLAAAYVAGVTKVFTVGGAQAIAALAYGT
ETIPQVDKITGPGNAFVAAAKRRVFGVVGIDMVAGPSEILVIADGTTPAD
WVAMDLFSQAEHDEIAQAILIGTSQAYLDEVEAAMDRLIETMPRRDIIEA
SLGNRGAMILVKDLNEACEISNYISPEHLELSVENPQEWAKKIRHAGAIF
MGRYTGESLGDYCAGPNHVLPTSRTARFSSPLGTYDFQKRSSLIQVSEQG
AQKLGETASVLAHGESLTAHARAAEFRMK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAACTCAACACCCAATCGCCCGATTTCCAAGCCGGACTCAAAGC
CCTGCTGGCTTTTGAAACCGCGCAAAACCCCGAAACCGAACGCATCGTCG
CCGACATTTGCGCCGACGTGCAAAAGCGCGGCGATGCGGCTTTGATTGAA
TACACCAACAAATTCGATCAGACAAACGCTAAAAGCATCGATGATTTAAT
ACTCACGCAAGCCGATTTGAACGCGGCGTTCGAGCGCATTCCGAACGACG
TTCAGACAGCATTGCAGACCGCCGCCCGCCGTGTCGAAAGCTACCACCAA
CGCCAAAAAATGGAATCGTGGAGCTACACCGATGAAGACGGCACGCTGCT
GGGGCAACAGATTACCCCGCTTGACCGCGTCGGCATTTACGTCCCAGGCG
GCAAGGCGGCATATCCGAGTTCCGTCATCATGAACGCGATGCCCGCCCAC
GTCGCAGGCGTGAAAGAAATCATTATGGTCGTACCGACACCGAAAGGCGA
ACGCAACGACATCGTGCTTGCCGCCGCATACGTCGCCGGCGTAACCAAAG
TCTTCACCGTCGGCGGCGCGCAAGCCATCGCCGCCCTCGCCTACGGCACG
GAAACCATCCCCCAAGTCGATAAAATCACCGGTCCGGGCAACGCCTTCGT
CGCCGCCGCCAAACGCCGCGTGTTCGGCGTGGTCGGCATCGACATGGTGG
CGGGGCCGTCTGAAATACTGGTCATCGCCGACGGCACGACACCCGCCGAT
TGGGTGGCGATGGATTTGTTCAGCCAGGCCGAACACGACGAAATTGCCCA
AGCCATCCTCATCGGCACGTCGCAAGCGTATCTCGACGAAGTAGAAGCCG
CTATGGACAGGCTCATCGAAACCATGCCGCGCCGCGACATCATCGAGGCC
TCGCTCGGCAACAGGGGCGCGATGATACTCGTTAAAGACTTGAACGAAGC
CTGCGAAATCTCCAACTACATTTCCCCCGAACACTTGGAACTGTCAGTCG
AAAACCCGCAGGAATGGGCGAAAAAAATCCGCCATGCCGGCGCGATTTTC
ATGGGACGCTACACCGGCGAAAGCCTCGGCGACTACTGCGCCGGCCCGAA
CCATGTGTTGCCCACCAGCCGAACCGCCCGCTTTTCCTCGCCTTTGGGGA
CATATGATTTCCAAAAACGCTCCAGCCTGATTCAGGTTTCGGAACAGGGC
GCGCAAAAATTAGGCGAAACCGCCAGCGTGCTGGCACACGGCGAAAGCCT
GACCGCCCACGCACGCGCGGCAGAGTTCCGTATGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy