Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR1004 IGR1002 IGR1006 IGR1008 IGR1005 IGR1007 IGR1009 IGR1003 ilvH, - NG1235 ilvI, - NG1236 NG1244 NG1237 hisB, - NG1242 hisG, - NG1238 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 ilvH, - NG1235 ilvI, - NG1236 NG1244 NG1237 hisB, - NG1242 hisG, - NG1238 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 Type: tandem, Name:  - 58 ilvH, - NG1235 ilvI, - NG1236 NG1237 hisB, - NG1242 hisG, - NG1238 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 NG1244
* Calculated from Protein Sequence

Gene ID: NG1239

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Neisseria-specific protein, uncharacterized

Gene Start:
1190468

Gene Stop:
1191352

Gene Length:
885

Molecular Weight*:
33002

pI*:
9.90

Net Charge*:
10.27

EC:
 

Functional Class:
Neisseria-specific protein  
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.1239

Blast Summary:  PSI-Blast Search
Single match in gapped Blast to NMA1769, a hypothetical in N.meningitidis (gb|AAF41933).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1239 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MVAKIKKFSDSTLSVLNNGERRFYVYCLTDLKKDKILYIGKGCGNRIFEH
EWVASRSQDPVSGEIIDRKLKAISKCKKLGRYIISYHLTEVEALAAESAL
IHFVKSVLGKKLKNKIAGHGPGGISVEELDRRFGFSSLPLSEINPDGLIL
AIKIHNAFDLDTDEELDYLFDNQDDANLKSRTLGNWVIGKDVASKVKYVI
GVHTGLQNAVVSAYEVDGFETMTEETKNGRKQTRYRFRTTSRSEEVLAKL
GLQQKCLPELKFGSGGGKAYIRPKTEQETLQTIPSPKITKENPKS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTGCAAAAATAAAAAAATTCTCAGATTCGACCCTTTCCGTTTTGAA
TAACGGCGAGCGTCGGTTTTATGTCTATTGTCTGACCGACCTGAAAAAAG
ACAAAATCCTCTACATCGGAAAAGGTTGCGGTAATCGTATCTTCGAGCAT
GAATGGGTTGCTAGTCGTTCACAAGACCCAGTCTCCGGCGAGATTATCGA
TCGGAAACTCAAAGCCATCTCCAAATGCAAGAAACTCGGTCGCTATATCA
TCAGCTATCATCTGACTGAAGTCGAAGCGCTCGCCGCCGAATCTGCCTTA
ATTCATTTTGTTAAATCTGTCTTGGGTAAAAAACTCAAAAATAAAATTGC
CGGGCATGGTCCGGGTGGTATTAGCGTAGAAGAACTAGATCGCCGCTTTG
GATTCTCTTCTCTCCCACTTAGCGAGATTAACCCCGACGGGCTGATTCTC
GCCATCAAAATCCACAATGCTTTCGATTTAGATACTGACGAAGAATTAGA
CTACCTTTTCGACAACCAAGACGATGCCAACCTCAAATCGCGTACGTTGG
GCAACTGGGTTATCGGTAAAGATGTTGCTTCAAAAGTGAAATACGTTATC
GGCGTTCACACCGGTCTGCAAAACGCTGTTGTCAGTGCGTACGAAGTGGA
CGGTTTTGAAACAATGACTGAGGAAACCAAAAACGGCAGAAAACAAACCC
GTTACCGTTTCCGTACTACCTCTCGTAGCGAAGAGGTATTAGCCAAACTC
GGTCTGCAACAAAAATGCCTGCCCGAATTGAAGTTTGGTAGCGGGGGAGG
AAAAGCGTATATCAGACCCAAAACCGAGCAAGAGACGCTTCAGACGATCC
CAAGTCCCAAAATAACAAAGGAGAATCCCAAATCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy