Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR1004 IGR1002 IGR1006 IGR1001 IGR1008 IGR1000 IGR1005 IGR1007 IGR1003 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1237 hisG, - NG1238 hisB, - NG1242 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1237 hisG, - NG1238 hisB, - NG1242 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 Type: tandem, Name:  - 58 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1234 NG1237 hisG, - NG1238 hisB, - NG1242 yhaE, - NG1243 NG1239 hisC, - NG1241 hisD,hisX, - NG1240
* Calculated from Protein Sequence

Gene ID: NG1238

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hisG  

Definition:
ATP phosphoribosyltransferase

Gene Start:
1189642

Gene Stop:
1190373

Gene Length:
732

Molecular Weight*:
26232

pI*:
8.10

Net Charge*:
2.35

EC:
2.4.2.17  

Functional Class:
Amino acid biosynthesis; Histidine family  

Pathway: pathway table
Histidine metabolism

Comment:
Oklahoma ID: NGO.1238

True start may be upstream of predicted start.

For other 'his' genes, see NG0210 (hisI), NG0211 (hisF), NG0212 (hisA), NG0213 (hisH), NG0397 (HisZ), NG0426 (hisS), NG1152 (hisJ), NG0185 (his2), NG1240 (hisD), NG1241 (hisC), NG1242 (hisB).

Blast Summary:  PSI-Blast Search
Numerous matches to ATP phosphoribosyltransferases. Residues 29-240 are 60% similar to the enzyme from P.aeruginosa (gb|AAG07837).

Residues 24-240 are virtually identical to NMA1768 in N.meningitidis (gb|AAF41932).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0040
COG name: ATP phosphoribosyltransferase (histidine biosynthesis)
Functional Class:  E
The phylogenetic pattern of COG0040 is amT-yqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001348 (ATP phosphoribosyltransferase) with a combined E-value of 1.2e-30.
    IPB001348A    28-51
    IPB001348B    81-103
    IPB001348C    115-127
    IPB001348D    168-199


ProDom Summary:  Protein Domain Search
Residues 81-222 are 52% similar to a (ATP PHOSPHORIBOSYLTRANSFERASE TRANSFERASE) protein domain (PD003516) which is seen in HIS1_BACSU.



Paralogs:  Local Blast Search


NG1238 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 77 to 237 (E-value = 4.7e-52) place NG1238 in the HisG family which is described as ATP phosphoribosyltransferase (PF01634)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1NH7|1NH7-A ATP PHOSPHORIBOSYLTRANSFERASE (ATP-PRTASE) FROM 81.5 1e-16

Gene Protein Sequence:
MPSAPPVPVQTALLFQPTKDIHTMQDNALTIALSKGRIFEETLPLLAAAG
IAPTEEPEKSRKLIIGTNHENIRLVIVRATDVPTYVRYGAADFGIAGKDV
LIEHGGTGLYRPLDLEIAKCRMMVAVRKGFDYEAASQPGCRLKIATKYPE
IAASHFAGKGVHVDIIKLYGSMELAPLVGLSDAIVDLVSTGNTLKANGLE
AVEHIVDISSYLVVNKAALKTKYALLEPIIQSFGGAVKAKWAFI

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGTCTGCACCGCCGGTGCCTGTTCAGACGGCATTATTGTTTCAACC
GACAAAGGACATCCACACCATGCAGGATAATGCTTTGACCATCGCCTTAT
CCAAAGGGCGCATTTTTGAGGAGACGCTGCCGCTGCTTGCCGCTGCCGGC
ATTGCTCCGACTGAAGAGCCCGAAAAATCGCGCAAGCTGATTATCGGGAC
GAACCATGAAAACATCCGCCTTGTCATTGTCCGCGCAACCGATGTGCCGA
CTTATGTCCGCTACGGCGCGGCGGACTTCGGCATTGCGGGCAAAGACGTG
CTGATCGAACACGGCGGCACGGGGCTTTACCGGCCTTTGGATTTGGAGAT
TGCCAAGTGCCGCATGATGGTTGCTGTGCGTAAAGGGTTTGATTACGAAG
CCGCTTCGCAACCCGGATGCCGTCTGAAGATTGCCACGAAGTATCCTGAA
ATCGCGGCATCTCATTTTGCCGGCAAGGGTGTCCATGTGGACATTATCAA
ACTGTACGGCTCGATGGAACTTGCGCCGCTGGTCGGCTTGAGCGATGCGA
TTGTGGACTTGGTTTCGACGGGAAACACCTTGAAGGCAAACGGCTTGGAG
GCAGTCGAACACATCGTCGACATTTCCAGCTACCTGGTGGTCAACAAGGC
TGCTTTGAAAACGAAATACGCGCTGCTGGAGCCGATTATTCAGTCGTTCG
GCGGCGCAGTGAAGGCGAAGTGGGCATTCATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy