Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR1004 IGR1002 IGR1006 IGR1001 IGR1000 IGR1005 IGR1007 IGR1003 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1237 hisB, - NG1242 hisG, - NG1238 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1237 hisB, - NG1242 hisG, - NG1238 NG1239 hisC, - NG1241 hisD,hisX, - NG1240 Type: tandem, Name:  - 58 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1234 NG1237 hisB, - NG1242 hisG, - NG1238 NG1239 hisC, - NG1241 hisD,hisX, - NG1240
* Calculated from Protein Sequence

Gene ID: NG1237

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (SCO1/SCO2 family)

Gene Start:
1188979

Gene Stop:
1189629

Gene Length:
651

Molecular Weight*:
23092

pI*:
4.90

Net Charge*:
-4.66

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.1237

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to SCO1/SCO2 family proteins. Residues 64-217 are 44% similar to a conserved hypothetical in Aquifex aeolicus (gb|AAC07080).

Residues 1-217 are virtually identical to a conserved hypothetical protein NMB1578 in N.meningitidis (gb|AAF41931).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1999
COG name: Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems
Functional Class:  R
The phylogenetic pattern of COG1999 is ----Yq---b----------X
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003782 (SCO1/SenC) with a combined E-value of 1.1e-41.
    IPB003782A    86-97
    IPB003782B    117-162
    IPB003782C    178-194


ProDom Summary:  Protein Domain Search
Residues 116-194 are 45% similar to a (PROTEIN SCO2 PRECURSOR SENC) protein domain (PD004602) which is seen in Q9ZCW7_RICPR.

Residues 59-139 are 39% similar to a (PROTEIN) protein domain (PD034290) which is seen in O67938_AQUAE.

Residues 59-100 are 61% similar to a (PROTEIN SCO2 PRECURSOR SENC) protein domain (PD035772) which is seen in SCO2_YEAST.

Residues 63-196 are 30% similar to a (MNXC PROTEIN ILVA 3'REGION) protein domain (PD102025) which is seen in YPMQ_BACSU.



Paralogs:  Local Blast Search


NG1237 is paralogously related to NG2124 (cytochrome c biogenesis protein CycX homolog; thioredoxin) (2e-04).


Pfam Summary:  Pfam Search
Residues 28 to 204 (E-value = 8e-42) place NG1237 in the SCO1-SenC family which is described as SCO1/SenC (PF02630)

Structural Feature(s):
Feature Type  Start  Stop
may be a lipoprotein  
  
non-globular  
1  
46

PDB Hit:
pdb|1QQ2|1QQ2-A CRYSTAL STRUCTURE OF A MAMMALIAN 2-CYS 40.6 2e-04
pdb|1E2Y|1E2Y-A TRYPAREDOXIN PEROXIDASE FROM CRITHIDIA 177.0 2e-45
pdb|1QQ2|1QQ2-A CRYSTAL STRUCTURE OF A MAMMALIAN 2-CYS 170.0 2e-43
pdb|1QMV|1QMV-A THIO

Gene Protein Sequence:
MFSVPRSFLPGVFVLAALAACKPQDNSAAQAASSSASAPAAENAAKPQTR
GTDMRKEDIGGDFTLTDGEGKPFSLSDLKGKVVILSFGFTHCPDVCPTGL
LTYSDTLKQLGGQAKDVKVVFVSIDPERDTPEIIGKYAKQFNPDFIGLTA
TGGQNLPVIKQQYRVVSAKINQKDDSENYLVDHSSGAYLIDKNGEVAIFS
PYGSEPETIAADVRTLL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTCCGTACCGCGTTCCTTTTTGCCGGGCGTTTTCGTACTTGCCGC
GCTTGCCGCCTGCAAACCTCAAGACAACAGTGCGGCGCAAGCCGCTTCTT
CAAGTGCATCCGCGCCGGCTGCGGAAAATGCGGCAAAGCCGCAAACGCGC
GGTACGGATATGCGTAAGGAAGACATCGGCGGCGATTTCACACTGACCGA
CGGCGAAGGCAAGCCTTTCAGCCTGAGCGATTTGAAAGGCAAGGTCGTGA
TTCTGTCTTTCGGCTTTACGCACTGTCCCGATGTCTGCCCGACAGGGCTT
TTGACGTACAGCGACACTTTGAAGCAGTTGGGCGGGCAGGCTAAGGACGT
GAAAGTGGTGTTCGTCAGCATCGATCCGGAACGCGACACGCCTGAAATCA
TCGGCAAGTATGCCAAACAGTTCAATCCGGACTTTATCGGTCTGACGGCA
ACGGGCGGCCAAAACCTGCCGGTCATCAAGCAGCAATACCGCGTGGTTTC
TGCCAAAATCAATCAAAAAGACGACAGCGAAAACTATTTGGTCGACCACT
CTTCCGGTGCGTATCTTATCGATAAAAACGGTGAGGTTGCCATTTTCTCG
CCTTACGGAAGCGAGCCGGAAACGATTGCTGCCGATGTAAGGACCCTGCT
C


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy