Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR1004 IGR1002 IGR1001 IGR1000 IGR1005 IGR0999 IGR0998 IGR1003 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1237 hisG, - NG1238 NG1239 otcC,argF, - NG1232 hisD,hisX, - NG1240 acnB, - NG1231 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1237 hisG, - NG1238 NG1239 otcC,argF, - NG1232 hisD,hisX, - NG1240 acnB, - NG1231 Type: tandem, Name:  - 58 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1234 NG1237 hisG, - NG1238 NG1239 otcC,argF, - NG1232 hisD,hisX, - NG1240 acnB, - NG1231
* Calculated from Protein Sequence

Gene ID: NG1236

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ilvI  

Definition:
acetolactate synthase isozyme III large subunit

Gene Start:
1187914

Gene Stop:
1186190

Gene Length:
1725

Molecular Weight*:
62848

pI*:
6.10

Net Charge*:
-5.79

EC:
1.2.3.3  4.1.3.18  

Functional Class:
Amino acid biosynthesis; Branched chain amino acid family  
Other categories; Other  

Pathway: pathway table
C5-Branched dibasic acid metabolism
Pyruvate metabolism

Secondary Evidence:
Squires,C.H., De Felice,M., Devereux,J. and Calvo,J.M.
Molecular structure of ilvIH and its evolutionary relationship to
ilvG in Escherichia coli K12
Nucleic Acids Res. 11 (15), 5299-5313 (1983)
M:83272971


Comment:
Oklahoma ID: NGO.1236c

For the small subunit (IlvH), see NG1235.

For other Ilv proteins, see: See also ilvA, NG0444; ilvC, NG1233; ilvE, NG1665, and ilvD, NG0809.

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to acetolactate synthase large subunit sequences. Residues 3-571 are 57% similar to the subunit from P.aeruginosa (gb|AAG08082).

Residues 1-575 are virtually identical to NMA1766 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0028
COG name: Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase]
Functional Class:  E,H
The phylogenetic pattern of COG0028 is AMT-YqvCEBRH---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000399 (Thiamine pyrophosphate dependent enzyme) with a combined E-value of 1.9e-87.
    IPB000399A    13-36
    IPB000399B    49-62
    IPB000399C    73-96
    IPB000399D    257-286
    IPB000399E    420-459


ProDom Summary:  Protein Domain Search
Residues 4-242 are 55% similar to a (THIAMINE FLAVOPROTEIN PYROPHOSPHATE LYASE SYNTHASE) protein domain (PD000376) which is seen in ILVI_HAEIN.

Residues 376-553 are 60% similar to a (THIAMINE FLAVOPROTEIN PYROPHOSPHATE LYASE SYNTHASE) protein domain (PD000397) which is seen in ILVI_ECOLI.

Residues 243-371 are 52% similar to a (SYNTHASE FLAVOPROTEIN THIAMINE PYROPHOSPHATE) protein domain (PD000679) which is seen in ILVI_ECOLI.



Paralogs:  Local Blast Search


NG1236 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 173 (E-value = 6.3e-96) place NG1236 in the TPP_enzyme_N family which is described as Thiamine pyrophosphate enzyme, N-terminal TPP binding domain (PF02776)
Residues 193 to 353 (E-value = 2.6e-56) place NG1236 in the TPP_enzyme_M family which is described as Thiamine pyrophosphate enzyme, central domain (PF00205)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
271  
347

PDB Hit:
pdb|1JSC|1JSC-A CRYSTAL STRUCTURE OF THE CATALYTIC SUBUNIT OF 432.0 0e+00
pdb|1N0H|1N0H-A CRYSTAL STRUCTURE OF YEAST ACETOHYDROXYACID 432.0 0e+00
pdb|1POW|1POW-A PYRUVATE OXIDASE (E.C.1.2.3.3) (WILD TYPE) 211.0 2e-55
pdb|1POX|1POX-A PYRU

Gene Protein Sequence:
MQLSGAQIIVQSLKAEGVEYVFGYPGGAVIEIYDALFQLNKFKHILTRHE
QAAVHAADAYARVSGKVGVALVTSGPGVTNALTGIATAYTDSIPMVVISG
QVGNSLIGTDAFQEVDTVGITRPCVKHNFLVTDINELVETIKKAFQIAAS
GRPGPVVLDVPKDVTQAMAKFSYPQEDIFIRSYQPVVQGHIGQIKKAVQM
LASAKRPVVYFGGGVVLGNASEELTRFVRMTGAPCTGTLMGLGAYPSGDR
QFLGMLGMHGTYEANLAMQNADVVLAVGARFDDRVVSVPSKFFEKAKKVI
HIDVDPSSIAKRVKADIPIVGDVKNILSEMVALWQKQESVPSEDALGKWW
KTIEEWRSRDCLWFDNGSEIIKPQYVIQKLAEITGNSAIITSDVGQHQMF
AAQYYPFERPRQWLNSGGLGTMGVGLPYAIGAKLAAPDQDVFCITGDGSI
QMNIQELSTCFQYRIPVNVITLNNGYLGMVRQWQEIYYGGRESETYFDSL
PDFVKLAEAYGHIGIRVDNKSDVEGALLEALNQKDRLVFIDFLTDQKQNV
MPMVGNGKGLDEMVLPPHMRTDGKA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGTTATCAGGCGCGCAAATCATAGTGCAGAGTCTCAAAGCCGAAGG
CGTCGAGTACGTTTTCGGTTATCCCGGCGGTGCGGTTATCGAAATCTACG
ATGCCCTGTTCCAACTCAATAAATTCAAACACATTCTTACCCGCCATGAG
CAGGCGGCAGTACACGCGGCAGATGCGTATGCGCGCGTCAGCGGTAAGGT
GGGCGTGGCATTGGTTACATCCGGCCCGGGCGTTACCAATGCGCTGACCG
GTATTGCTACTGCCTATACGGATTCGATTCCGATGGTGGTCATCAGCGGA
CAGGTAGGCAATTCCCTGATTGGTACGGATGCGTTCCAAGAAGTTGATAC
GGTGGGTATTACCCGTCCGTGCGTCAAACACAATTTCTTGGTTACGGACA
TCAATGAGTTGGTGGAAACCATTAAAAAGGCGTTCCAAATTGCCGCAAGC
GGCCGACCGGGGCCCGTGGTGCTTGATGTCCCGAAAGATGTTACGCAGGC
GATGGCGAAATTCAGCTATCCTCAGGAAGACATTTTTATCCGTTCGTATC
AACCGGTTGTTCAAGGGCATATCGGTCAGATTAAAAAGGCCGTGCAGATG
TTGGCATCTGCCAAACGCCCGGTCGTCTATTTTGGCGGCGGCGTGGTGTT
GGGTAATGCTTCTGAAGAGCTGACCCGATTTGTCCGAATGACGGGTGCTC
CGTGCACGGGTACGCTGATGGGCTTGGGCGCTTATCCTTCCGGCGACCGC
CAATTCCTCGGTATGCTCGGTATGCACGGTACTTACGAGGCAAACCTTGC
CATGCAGAATGCGGATGTCGTTCTTGCCGTAGGTGCGCGTTTTGACGACC
GTGTGGTTTCCGTACCGTCCAAATTTTTCGAGAAGGCGAAGAAGGTTATC
CATATCGATGTCGATCCTTCCAGCATCGCCAAACGCGTGAAGGCGGACAT
TCCGATTGTCGGCGACGTGAAAAACATTTTGTCCGAGATGGTTGCGCTGT
GGCAAAAACAAGAGTCCGTGCCGTCTGAAGATGCTTTGGGCAAATGGTGG
AAAACCATAGAGGAATGGCGTTCCCGCGATTGCTTGTGGTTTGACAACGG
CAGCGAAATTATCAAGCCCCAATATGTGATTCAGAAGCTTGCCGAGATTA
CCGGCAATTCGGCAATCATCACATCGGATGTAGGGCAGCATCAAATGTTT
GCGGCTCAATATTATCCTTTCGAACGTCCGCGCCAATGGCTCAACTCCGG
CGGTTTGGGTACGATGGGCGTGGGTCTGCCTTATGCGATTGGTGCAAAAC
TTGCCGCCCCGGATCAAGACGTATTCTGTATTACCGGCGACGGCTCGATC
CAGATGAACATCCAAGAGTTGTCCACCTGTTTCCAATATCGGATTCCGGT
TAACGTCATTACGCTGAACAACGGTTATCTGGGTATGGTACGCCAGTGGC
AGGAAATATATTACGGCGGTCGAGAGTCGGAAACCTATTTCGATTCTTTG
CCCGATTTCGTCAAACTTGCCGAGGCATACGGCCATATCGGCATCCGCGT
GGACAATAAATCTGATGTGGAAGGTGCCTTGTTGGAAGCATTGAACCAAA
AAGACAGGCTGGTGTTTATCGACTTCCTGACCGACCAGAAACAGAATGTG
ATGCCTATGGTCGGCAACGGCAAAGGTTTGGACGAAATGGTACTTCCGCC
GCATATGCGTACGGACGGAAAGGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy