Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR1004 IGR1002 IGR1001 IGR1000 IGR1005 IGR0999 IGR0998 IGR1003 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1237 hisG, - NG1238 NG1239 otcC,argF, - NG1232 acnB, - NG1231 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1237 hisG, - NG1238 NG1239 otcC,argF, - NG1232 acnB, - NG1231 Type: tandem, Name:  - 58 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1234 NG1237 hisG, - NG1238 NG1239 otcC,argF, - NG1232 acnB, - NG1231
* Calculated from Protein Sequence

Gene ID: NG1235

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ilvH  

Definition:
acetolactate synthase isozyme III small subunit

Gene Start:
1186176

Gene Stop:
1185688

Gene Length:
489

Molecular Weight*:
18277

pI*:
5.50

Net Charge*:
-2.51

EC:
4.1.3.18  

Functional Class:
Amino acid biosynthesis; Branched chain amino acid family  

Pathway: pathway table
Butanoate metabolism
C5-Branched dibasic acid metabolism
Pantothenate and CoA biosynthesis
Valine, leucine and isoleucine biosynthesis

Secondary Evidence:
Squires,C.H., De Felice,M., Devereux,J. and Calvo,J.M.
Molecular structure of ilvIH and its evolutionary relationship to
ilvG in Escherichia coli K12
Nucleic Acids Res. 11 (15), 5299-5313 (1983)
M:83272971

Comment:
Oklahoma ID: NGO.1235c

For the large subunit (IlvI), see NG1236.

For other Ilv proteins, see: ilvA, NG0444; ilvC, NG1233; ilvE, NG1665, and ilvD, NG0809.

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to acetolactate synthase small chain sequences. Residues 1-163 are 63% similar to the small chain P.aeruginosa (gb|AAG08081).

Residues 1-163 are virtually identical to NMA1765 in N.meningitidis (gb|AAF41929).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0440
COG name: Acetolactate synthase, small subunit
Functional Class:  E
The phylogenetic pattern of COG0440 is AmT-yqvcEbrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-90 are 68% similar to a (SYNTHASE ACETOLACTATE SMALL SUBUNIT) protein domain (PD002844) which is seen in ILVH_ECOLI.

Residues 91-157 are 47% similar to a (SYNTHASE ACETOLACTATE SMALL SUBUNIT) protein domain (PD002971) which is seen in ILVH_HAEIN.



Paralogs:  Local Blast Search


NG1235 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 76 (E-value = 4e-18) place NG1235 in the ACT family which is described as ACT domain (PF01842)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MRHILSVLIENESGAMSRVVGLFSARDYNIDSLAVAPTEDKTLSRMTIVT
HGDEQVIEQITKQLNKLIEVIKVVDLNESRFVERELMLVKVRAAGKDRDE
FLRLTEIYRGSIIDVTDRSYTIEITGSTDKLDSFLETVGRAQILETVRTG
AAGIGRGERILKI

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGACATATCTTATCTGTTCTGATCGAAAACGAATCAGGTGCGATGAG
CCGCGTGGTCGGTTTGTTCTCTGCACGCGATTACAATATCGATTCTTTGG
CGGTTGCGCCGACCGAAGACAAAACCCTGTCACGGATGACCATCGTTACC
CACGGCGACGAGCAGGTTATCGAACAAATCACCAAGCAACTCAATAAATT
GATTGAAGTGATTAAAGTGGTCGATTTGAACGAAAGCCGTTTTGTCGAAC
GCGAACTGATGTTGGTAAAAGTCCGTGCCGCCGGCAAAGACCGCGACGAA
TTTTTACGCTTGACCGAAATCTACCGGGGCAGCATCATCGACGTAACCGA
CCGCAGCTATACGATTGAAATTACCGGCTCGACCGACAAGCTGGATTCCT
TTTTGGAAACGGTCGGACGCGCCCAAATTTTGGAAACCGTACGTACAGGT
GCGGCCGGCATCGGTCGCGGTGAGCGTATTTTGAAAATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy