Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR1004 IGR1002 IGR1001 IGR1000 IGR1005 IGR0999 IGR0998 IGR1003 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1237 hisG, - NG1238 NG1239 otcC,argF, - NG1232 acnB, - NG1231 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1237 hisG, - NG1238 NG1239 otcC,argF, - NG1232 acnB, - NG1231 Type: tandem, Name:  - 58 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1234 NG1237 NG1239 otcC,argF, - NG1232 acnB, - NG1231 hisG, - NG1238
* Calculated from Protein Sequence

Gene ID: NG1234

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
1185618

Gene Stop:
1185328

Gene Length:
291

Molecular Weight*:
10816

pI*:
5.20

Net Charge*:
-3.29

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.1234c

Blast Summary:  PSI-Blast Search
Limited matches in gapped BLAST to conserved hypothetical proteins. Residues 4-77 are 47% similar to YCNE_BACSU (D50453).

Residues 1-96 are virtually identical to NMB1575 in N.meningitidis (gb|AAF41928).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1359
COG name: Uncharacterized ACR, YneC family
Functional Class:  S
The phylogenetic pattern of COG1359 is -------cEbR----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003771 (DUF176) with a combined E-value of 1.3e-34.
    IPB003771A    10-44
    IPB003771B    52-87


ProDom Summary:  Protein Domain Search
Residues 4-77 are 47% similar to a (PROTEIN INTERGENIC REGION PHRC-GDH SLL1783 HIPB-UXAB) protein domain (PD020128) which is seen in YCNE_BACSU.



Paralogs:  Local Blast Search


NG1234 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 12 to 75 (E-value = 9.5e-24) place NG1234 in the ABM family which is described as Antibiotic biosynthesis monooxygenase (PF03992)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
21

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSNIKIVALVTVKPEYTETLAAQFKELVKASRAEEGNISYNLHQEIGKPN
RFVFVENWKSQAAIDEHNASAHFQAFVQSVDGKTEALEIVLMNEVAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGAACATTAAAATTGTCGCACTGGTTACCGTCAAACCGGAATACAC
GGAAACACTGGCAGCACAGTTTAAAGAACTGGTCAAAGCCAGCCGTGCGG
AAGAGGGCAACATCAGCTACAATCTCCATCAGGAAATCGGCAAACCGAAC
CGTTTTGTTTTCGTGGAAAATTGGAAATCCCAAGCAGCTATTGACGAACA
TAATGCCAGCGCGCATTTCCAAGCCTTCGTCCAGTCCGTCGACGGCAAAA
CCGAAGCGTTGGAAATCGTATTGATGAATGAAGTTGCCGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy