Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-4 IGR0996 IGR1004 IGR1002 IGR1001 IGR1000 IGR0999 IGR0998 IGR0997 IGR1003 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1230 NG1237 hisG, - NG1238 otcC,argF, - NG1232 NG1229 acnB, - NG1231 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1230 NG1237 hisG, - NG1238 otcC,argF, - NG1232 NG1229 acnB, - NG1231 Type: tandem, Name:  - 58 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1234 hisG, - NG1238 otcC,argF, - NG1232 NG1229 acnB, - NG1231 NG1230 NG1237
* Calculated from Protein Sequence

Gene ID: NG1233

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ilvC  

Definition:
ketol-acid reductoisomerase

Gene Start:
1185245

Gene Stop:
1184235

Gene Length:
1011

Molecular Weight*:
36405

pI*:
6.20

Net Charge*:
-4.67

EC:
1.1.1.86  

Functional Class:
Amino acid biosynthesis; Branched chain amino acid family  

Pathway: pathway table
Pantothenate and CoA biosynthesis
Valine, leucine and isoleucine biosynthesis

Secondary Evidence:
Wek,R.C. and Hatfield,G.W.
Nucleotide sequence and in vivo expression of the ilvY and ilvC
genes in Escherichia coli K12. Transcription from divergent
overlapping promoters
J. Biol. Chem. 261 (5), 2441-2450 (1986)
M:86111952


Comment:
See also ilvA, NG0444; ilvH, NG1235; ilvI, NG1236; ilvE, NG1665, and ilvD, NG0809.

Oklahoma ID: NGO.1233c

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ketol-acid reductoisomerase sequences. Residues 1-337 are 73% similar to the enzyme from P.aeruginosa (gb|AAG08080).

Residues 1-337 are virtually identical to NMA1763 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0059
COG name: Ketol-acid reductoisomerase (isoleucine biosynthesis)
Functional Class:  E
The phylogenetic pattern of COG0059 is amt-yqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000506 (Acetohydroxy acid isomeroreductase) with a combined E-value of 1.4e-139.
    IPB000506A    17-41
    IPB000506B    51-89
    IPB000506C    118-154
    IPB000506D    170-219
    IPB000506E    228-256


ProDom Summary:  Protein Domain Search
Residues 3-325 are 62% similar to a (REDUCTOISOMERASE KETOL-ACID ACETOHYDROXY-ACID) protein domain (PD002380) which is seen in ILVC_SYNY3.



Paralogs:  Local Blast Search


NG1233 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 182 to 327 (E-value = 9.9e-75) place NG1233 in the IlvC family which is described as Acetohydroxy acid isomeroreductase, catalytic domain (PF01450)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
116
non-globular  
157  
243

PDB Hit:
pdb|1QMG|1QMG-A ACETOHYDROXYACID ISOMEROREDUCTASE COMPLEXED WITH115.0 2e-26
pdb|1BG6|1BG6 CRYSTAL STRUCTURE OF THE 44.5 3e-05
pdb|1QMG|1QMG-A ACETOHYDROXYACID ISOMEROREDUCTASE COMPLEXED WITH290.0 3e-79
pdb|1BG6|1BG6 CRYST

Gene Protein Sequence:
MQVYYDKDADLSLIKGKTVAIIGYGSQGHAHAANLKDSGVNVVIGLRHGS
SWKKAEAAGHVVKTVAEATKEADVVMLLLPDETMPAVYHAEVAANLKEGA
TLAFAHGFNVHYNQIVPRADLDVIMVAPKGPGHTVRSEYKRGGGVPSLIA
VYQDNSGKAKDIALSYAAANGGTKGGVIETTFREETETDLFGEQAVLCGG
VAELIKAGFETLTEAGYAPEMAYFECLHEMKLIVDLIFEGGIANMNYSIS
NNAEYGEYVTGPEVVNASSKEAMRNALKRIQTGEYAKMFIQEGNVNYASM
TARRRLNADHQVEKVGARLRAMMPWITANKLVDQDKN

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAGTCTATTACGATAAAGATGCCGATCTGTCCCTGATCAAAGGCAA
AACCGTTGCCATCATCGGTTACGGTTCGCAAGGTCATGCCCATGCTGCCA
ACCTGAAAGATTCGGGTGTAAACGTGGTGATCGGTCTGCGCCACGGCTCT
TCTTGGAAAAAAGCCGAAGCAGCCGGCCATGTTGTTAAAACCGTTGCTGA
AGCGACCAAAGAAGCCGATGTCGTTATGCTGCTGCTGCCTGACGAAACCA
TGCCTGCCGTCTATCACGCCGAAGTTGCAGCCAATTTGAAAGAAGGCGCG
ACGCTGGCATTTGCACACGGCTTCAACGTGCACTACAACCAAATCGTTCC
GCGTGCCGACTTGGACGTGATTATGGTTGCCCCCAAAGGTCCGGGTCATA
CCGTACGCAGTGAATACAAACGCGGCGGCGGCGTGCCTTCTCTGATTGCC
GTTTACCAAGACAATTCCGGCAAGGCCAAAGACATCGCCCTGTCTTATGC
GGCTGCCAACGGCGGCACCAAAGGCGGTGTGATTGAAACCACTTTCCGCG
AAGAAACCGAAACCGATCTGTTCGGCGAACAAGCCGTATTGTGCGGTGGC
GTGGCCGAGTTGATCAAAGCAGGTTTTGAAACCCTGACCGAAGCCGGTTA
CGCGCCTGAAATGGCTTACTTCGAATGCCTGCACGAAATGAAACTGATCG
TTGACCTGATTTTCGAAGGCGGTATTGCCAATATGAACTACTCCATTTCC
AACAATGCGGAGTACGGCGAATACGTTACCGGCCCTGAAGTGGTCAATGC
TTCCAGCAAAGAAGCCATGCGCAATGCCCTGAAACGCATCCAAACCGGCG
AATACGCAAAAATGTTTATCCAAGAGGGTAATGTCAACTACGCGTCTATG
ACTGCCCGCCGCCGTTTGAATGCCGACCACCAAGTTGAAAAAGTCGGCGC
ACGACTGCGTGCCATGATGCCTTGGATTACGGCCAACAAATTGGTTGACC
AAGACAAAAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy