Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0996 IGR1002 IGR1001 IGR1000 IGR0999 IGR0998 IGR0997 IGR1003 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1230 otcC,argF, - NG1232 NG1229 NG1228 acnB, - NG1231 NG1234 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1230 otcC,argF, - NG1232 NG1229 NG1228 acnB, - NG1231 Type: tandem, Name:  - 58 ilvH, - NG1235 ilvC, - NG1233 ilvI, - NG1236 NG1234 NG1230 otcC,argF, - NG1232 NG1229 NG1228 acnB, - NG1231
* Calculated from Protein Sequence

Gene ID: NG1232

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
otcC  argF  

Definition:
ornithine carbamoyltransferase (OTCase)

Gene Start:
1183118

Gene Stop:
1184110

Gene Length:
993

Molecular Weight*:
36632

pI*:
6.00

Net Charge*:
-5.66

EC:
2.1.3.3  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Arginine and proline metabolism
Urea cycle and metabolism of amino groups

Primary Evidence:
Martin,P.R., Cooperider,J.W. and Mulks,M.H.
Sequence of the argF gene encoding ornithine transcarbamoylase from Neisseria gonorrhoeae.
Gene 94 (1), 139-140 (1990)
M:91033057

Zhou,J. and Spratt,B.G.
Sequence diversity within the argF, fbp and recA genes of natural
isolates of Neisseria meningitidis: interspecies recombination
within the argF gene.
Mol. Microbiol. 6 (15), 2135-2146 (1992)
M:93023840



Comment:
See also: ArgA, NG0027; ArgB, NG0844; ArgC, NG0118; ArgD, NG0646; ArgG, NG1961; ArgH, NG0219; ArgJ, NG1194.

Oklahoma ID: NGO.1232

Blast Summary:  PSI-Blast Search
NG1232 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 150241, a predicted ornithine carbamoyltransferase. See also S24720, X64860, X64870, X64871, X64869, X64873, X64872, Y10880, AJ223883, Y10881, Y10878, AJ223886, Y10877, AJ223884, AJ223885, AJ223893, Y10876, AJ223905, AJ223894, AJ223890, AJ223896, AJ223887, AJ223897, AJ223904, AJ223895, AJ223902, AJ223898, AJ223899, AJ223900, AJ223901.

Numerous hits in gapped BLAST to ornithine carbamoyltransferase sequences. Residues 2-329 are 67% similar to the enzyme from Haemophilus paragallinarum (gb|AAD01405).

Residues 1-331 are virtually identical to NMA1762 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0078
COG name: Ornithine carbamoyltransferase
Functional Class:  E
The phylogenetic pattern of COG0078 is amtkyqvcEbrh---po----
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002029 (Aspartate and ornithine carbamoyltransferase family) with a combined E-value of 1.8e-62.
    IPB002029A    44-71
    IPB002029B    81-106
    IPB002029C    123-161
    IPB002029D    263-284


ProDom Summary:  Protein Domain Search
Residues 74-330 are 97% similar to a (CARBAMOYLTRANSFERASE TRANSFERASE BIOSYNTHESIS ORNITHINE) protein domain (PD000708) which is seen in OTCC_NEIGO.

Residues 6-66 are 77% similar to a (CARBAMOYLTRANSFERASE TRANSFERASE BIOSYNTHESIS ORNITHINE) protein domain (PD000765) which is seen in OTCC_NEIGO.



Paralogs:  Local Blast Search


NG1232 is paralogously related to NG1877 (aspartate carbamoyltransferase) (3e-15).


Pfam Summary:  Pfam Search
Residues 6 to 148 (E-value = 7e-87) place NG1232 in the OTCace_N family which is described as Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain (PF02729)
Residues 152 to 329 (E-value = 2e-103) place NG1232 in the OTCace family which is described as Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain (PF00185)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1DXH|1DXH-A CATABOLIC ORNITHINE CARBAMOYLTRANSFERASE FROM 441.0 0e+00
pdb|1ORT|1ORT-A ORNITHINE TRANSCARBAMOYLASE FROM PSEUDOMONAS 439.0 0e+00
pdb|1AKM|1AKM-A ORNITHINE TRANSCARBAMYLASE FROM ESCHERICHIA COLI406.0 0e+00
pdb|2OTC|2OTC-A ORNI

Gene Protein Sequence:
VNLKNRHFLKLLDFTPEEITTYLDLAAELKDAKKAGREIQRMKGKNIALI
FEKTSTRTRCAFEVAARDQGADATYLEPSASQIGHKESIKDTARVLGRMY
DAIEYRGFAQETVEELAKYAGVPVFNGLTNEFHPTQMLADALTMREHSGK
PLNQTAFAYVGDARYNMGNSLLILGAKLGMDVRIGAPQSLWPSEGIIAAA
HAAAKETGAKITLTENAHEAVKGVGFIHTDVWVSMGEPKEVWQERIDLLK
DYRVTPELMAASGNPQVKFMHCLPAFHNRETKVGEWIYETFGLNGVEVTE
EVFESPAGIVFDQAENRMHTIKAVMVAALGD

Gene Nucleotide Sequence:  Sequence Viewer
GTGAACCTGAAAAACCGCCATTTTCTGAAACTTTTGGACTTCACGCCGGA
AGAAATCACCACCTACCTCGACCTTGCCGCCGAGTTGAAAGACGCCAAAA
AGGCAGGGCGCGAGATTCAGCGGATGAAAGGGAAAAACATCGCCCTGATT
TTTGAAAAAACATCCACGCGCACACGCTGTGCGTTTGAAGTCGCCGCACG
CGACCAAGGCGCGGATGCAACCTATCTGGAACCGTCCGCCAGCCAAATCG
GGCACAAAGAAAGCATCAAAGACACGGCGCGCGTCTTAGGCAGAATGTAC
GATGCCATCGAATATCGCGGCTTCGCTCAGGAAACTGTCGAAGAATTGGC
AAAATATGCGGGCGTACCCGTGTTCAACGGGCTGACCAACGAGTTCCATC
CCACACAAATGCTTGCCGACGCACTGACTATGCGCGAACACAGCGGCAAA
CCTTTGAACCAAACCGCGTTTGCCTACGTCGGCGACGCGCGTTACAACAT
GGGCAATTCCCTGCTGATTTTAGGGGCAAAATTGGGGATGGACGTGCGTA
TCGGCGCACCTCAAAGCCTGTGGCCGTCTGAAGGCATTATCGCCGCCGCA
CACGCCGCCGCCAAAGAAACCGGTGCAAAAATTACCCTGACCGAAAACGC
GCATGAAGCCGTCAAAGGTGTCGGTTTCATTCATACTGACGTATGGGTCA
GCATGGGCGAGCCGAAAGAAGTCTGGCAGGAACGCATCGATTTGCTGAAA
GATTACCGCGTTACGCCCGAACTGATGGCGGCATCGGGCAATCCGCAAGT
CAAATTCATGCACTGCCTGCCCGCCTTCCACAACCGCGAAACCAAAGTCG
GCGAATGGATTTACGAAACCTTCGGGCTGAACGGTGTGGAAGTTACAGAA
GAAGTATTCGAAAGTCCGGCCGGCATCGTGTTCGATCAGGCGGAAAACCG
TATGCACACGATTAAAGCGGTAATGGTCGCGGCTCTGGGCGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy