Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0996 IGR1002 IGR1001 IGR1000 IGR0999 IGR0998 IGR0997 IGR0995 NG1234 ilvH, - NG1235 ilvC, - NG1233 ampA,pepA,lap, - NG1227 ilvI, - NG1236 NG1230 otcC,argF, - NG1232 NG1229 NG1228 acnB, - NG1231 NG1234 ilvH, - NG1235 ilvC, - NG1233 ampA,pepA,lap, - NG1227 ilvI, - NG1236 NG1230 otcC,argF, - NG1232 NG1229 NG1228 acnB, - NG1231 ilvH, - NG1235 ilvC, - NG1233 ampA,pepA,lap, - NG1227 ilvI, - NG1236 NG1234 NG1230 otcC,argF, - NG1232 NG1229 NG1228 acnB, - NG1231
* Calculated from Protein Sequence

Gene ID: NG1231

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
acnB  

Definition:
aconitate hydratase 2

Gene Start:
1180391

Gene Stop:
1182973

Gene Length:
2583

Molecular Weight*:
92728

pI*:
5.50

Net Charge*:
-13.34

EC:
4.2.1.3  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism
Reductive carboxylate cycle (CO2 fixation)

Secondary Evidence:
Gruer,M.J. and Guest,J.R.
Two genetically-distinct and differentially-regulated aconitases
(AcnA and AcnB) in Escherichia coli. Microbiology 140 (Pt 10), 2531-2541 (1994)
M:95093601


Comment:
Oklahoma ID: NGO.1231

NG0679 may serve as acn1 (acnA).

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to aconitate hydratase sequences. Residues 16-859 are 73% similar to ACO2_ECOLI ( gb|AAC73229).

Residues 1-861 are virtually identical to NMA1761 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1049
COG name: Aconitase B
Functional Class:  C
The phylogenetic pattern of COG1049 is -------ce---uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001030 (Aconitase (aconitate hydratase)) with a combined E-value of 2.6e-28.
    IPB001030A    381-429
    IPB001030B    751-774
    IPB001030C    785-799


ProDom Summary:  Protein Domain Search
Residues 490-818 are 78% similar to a (LYASE IRON-SULFUR 4FE-4S ISOMERASE HYDRATASE ACONITATE) protein domain (PD000511) which is seen in ACO2_ECOLI.



Paralogs:  Local Blast Search


NG1231 is paralogously related to NG0679 (3-isopropylmalate dehydratase large subunit) (2e-14).


Pfam Summary:  Pfam Search
Residues 2 to 380 (E-value = 1.6e-284) place NG1231 in the Aconitase_2_N family which is described as Aconitate hydratase 2 N-terminus (PF06434)
Residues 381 to 818 (E-value = 4.2e-10) place NG1231 in the Aconitase family which is described as Aconitase family (aconitate hydratase) (PF00330)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
133
transmembrane  
511  
527

PDB Hit:
pdb|1L5J|1L5J-A CRYSTAL STRUCTURE OF E. COLI ACONITASE B. 1260.0 0.000000
pdb|1C96|1C96-A S642A:CITRATE COMPLEX OF ACONITASE 55.0 5e-08
pdb|5ACN|5ACN ACONITASE (E.C.4.2.1.3) (INACTIVE (3FE-4S) 55.0 5e-08
pdb|1B0J|1B0J-A C

Gene Protein Sequence:
MLEAYRKAAAERAALGIPALPLNAQQTADLVELLKNPPAGEGEFLVELLA
HRVPPGVDDAAKVKASFLAAVAEGSASSPLVSPKYATELLGTMLGGYNIH
ALIELLDDDKLAPIAAKGLKHTLLMFDSFHDVQEKAEKGNKYAQEVLQSW
ADAEWFASRAKVPEKITVTVFKVDGETNTDDLSPAPDAWSRPDIPLHALA
MLKNPRDGITPDKPGEVGPIKLLEELKAKGHPVAYVGDVVGTGSSRKSAT
NSVIWHTGEDIPFVPNKRFGGVCLGGKIAPIFFNTQEDSGALPIEVDVSA
LKMGDVVNILPYEGKIVKNGETVAEFELKSQVLLDEVQAGGRINLIIGRG
LTAKAREALKLPASTAFRLPQAPAESKVGFTLAQKMVGRACGLPEGQGVR
PGTYCEPRMTTVGSQDTTGPMTRDELKDLACLGFSADMVMQSFCHTAAYP
KPVDVKTHKELPAFISTRGGVSLRPGDGVIHSWLNRLLLPDTVGTGGDSH
TRFPIGISFPAGSGLVAFAAATGVIPLDMPESVLVRFSGKLQPGVTLRDL
VNAIPLYAIKQGLLTVAKAGKKNIFSGRILEIEGLPDLKVEQAFELTDAS
AERSAAGCTVKLNKEPIIEYMKSNVVLMKNMIANGYQDPRALERRIKAME
KWLANPELLEADKDAEYAAVIEINMDDIKEPIIACPNDPDDVCFMSERSG
TKIDEVFIGSCMTNIGHFRAASKLLEGKSDIPVRLWVAPPTKMDAKELSD
EGHYGVLGRAGARMEMPGCSLCMGNQAQVREGATVMSTSTRNFPNRLGKN
TFVYLGSAELAAICSKLGKIPTVEEYQANIGIINEQGDKIYRYMNFNEID
SYNEVAETVNV

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGAAGCCTATCGTAAAGCCGCCGCCGAGCGCGCCGCCCTCGGCAT
TCCCGCCCTCCCTTTGAATGCGCAGCAAACCGCCGATTTGGTTGAGCTGC
TGAAAAACCCGCCCGCAGGCGAAGGCGAGTTCTTGGTCGAGCTGCTTGCC
CACCGTGTTCCGCCCGGTGTGGACGATGCCGCCAAAGTCAAAGCCTCATT
CCTGGCTGCCGTTGCCGAAGGCAGCGCATCCAGCCCGCTGGTTTCCCCCA
AATATGCGACCGAACTCTTAGGTACGATGCTCGGCGGTTACAATATCCAC
GCCTTAATCGAACTCTTGGACGACGACAAACTCGCGCCCATTGCCGCCAA
AGGCTTGAAACATACGCTTCTGATGTTCGATTCCTTCCACGACGTTCAGG
AAAAAGCCGAAAAAGGCAACAAATACGCGCAGGAAGTTTTGCAATCTTGG
GCAGATGCCGAATGGTTCGCCTCCCGTGCCAAAGTTCCCGAAAAAATCAC
CGTTACCGTCTTCAAAGTTGACGGCGAAACCAATACAGACGACCTCTCTC
CCGCGCCCGACGCGTGGAGTCGTCCCGATATTCCGCTGCACGCGCTGGCC
ATGCTGAAAAACCCGCGCGACGGCATCACGCCCGACAAACCGGGCGAAGT
CGGTCCGATTAAATTGTTGGAAGAACTCAAAGCCAAAGGCCATCCGGTTG
CCTACGTCGGTGACGTGGTCGGTACCGGTTCTTCACGCAAATCCGCGACC
AACTCCGTCATTTGGCATACCGGCGAAGACATCCCGTTCGTGCCGAACAA
ACGCTTCGGCGGCGTGTGCTTGGGCGGTAAAATCGCGCCGATTTTCTTCA
ACACTCAAGAAGACTCCGGCGCGCTGCCGATTGAAGTCGATGTTTCCGCG
CTGAAAATGGGCGATGTCGTCAATATCCTTCCTTATGAAGGTAAAATCGT
GAAAAACGGCGAGACTGTTGCCGAGTTTGAATTGAAATCACAAGTATTGC
TGGACGAAGTGCAAGCCGGCGGCCGTATCAACCTGATTATCGGTCGCGGT
CTGACCGCCAAAGCGCGCGAAGCCCTGAAACTGCCTGCCTCTACTGCATT
CCGCCTGCCGCAAGCGCCTGCCGAAAGCAAAGTCGGTTTTACCTTGGCGC
AAAAAATGGTCGGTCGCGCCTGCGGTCTGCCCGAAGGACAAGGCGTGCGT
CCGGGTACTTACTGCGAACCGCGCATGACGACGGTCGGCTCGCAAGATAC
GACCGGGCCGATGACCCGCGACGAGTTGAAAGACTTGGCTTGTTTGGGCT
TCTCCGCCGATATGGTGATGCAGTCTTTCTGCCACACCGCTGCCTATCCG
AAACCTGTCGATGTAAAAACCCATAAAGAACTGCCCGCCTTTATTTCTAC
CCGTGGCGGCGTGTCCCTGCGTCCGGGCGACGGCGTCATCCACTCATGGC
TCAACCGCCTGCTGTTGCCTGATACAGTCGGTACAGGCGGCGACAGCCAC
ACCCGTTTCCCCATCGGTATTTCCTTCCCCGCAGGTTCAGGCTTGGTCGC
TTTTGCCGCCGCAACGGGCGTAATACCGCTCGATATGCCCGAGTCCGTAT
TGGTACGTTTCAGCGGCAAGCTGCAACCGGGCGTAACCCTGCGCGATTTG
GTGAACGCCATCCCGCTTTACGCGATTAAACAAGGTTTGCTGACCGTTGC
CAAAGCCGGTAAGAAAAACATCTTCTCCGGCCGCATCCTCGAAATCGAAG
GCCTGCCCGATTTGAAAGTGGAACAAGCCTTTGAATTGACCGACGCATCC
GCCGAACGCTCCGCCGCCGGCTGTACCGTGAAGCTCAATAAAGAGCCGAT
TATCGAGTACATGAAATCCAACGTCGTGTTGATGAAAAATATGATTGCCA
ACGGCTATCAAGATCCGCGCGCTTTGGAACGCCGCATCAAAGCTATGGAA
AAATGGCTGGCAAATCCCGAGTTGCTCGAAGCGGATAAAGATGCCGAATA
CGCCGCCGTGATTGAAATCAACATGGACGACATCAAAGAGCCGATTATCG
CCTGCCCGAACGACCCGGACGACGTATGCTTTATGTCCGAACGCTCCGGC
ACCAAAATCGACGAAGTGTTCATCGGTTCTTGTATGACCAACATCGGCCA
CTTCCGCGCCGCCTCCAAACTTTTGGAAGGCAAGAGCGACATCCCCGTCC
GCCTGTGGGTAGCGCCGCCGACCAAAATGGACGCGAAAGAGTTGTCCGAC
GAAGGTCACTACGGCGTACTCGGCCGCGCCGGCGCGCGTATGGAAATGCC
GGGCTGTTCGTTGTGTATGGGTAACCAAGCCCAAGTACGCGAAGGTGCAA
CTGTCATGTCCACTTCGACCCGCAACTTCCCGAACCGCTTGGGTAAAAAC
ACCTTCGTTTACCTCGGCTCGGCAGAGTTGGCGGCGATTTGCTCCAAACT
GGGTAAAATCCCGACCGTTGAAGAATATCAAGCCAATATCGGCATCATCA
ACGAACAGGGCGATAAAATCTACCGCTATATGAACTTCAACGAAATCGAC
AGCTACAACGAAGTAGCCGAGACCGTGAATGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy