Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0996 IGR0991 IGR0994 IGR0992 IGR0997 IGR0995 IGR0990 IGR0993 IGR0989 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 mip,fklB, - NG1225 ampA,pepA,lap, - NG1227 NG1230 NG1229 NG1228 acnB, - NG1231 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 mip,fklB, - NG1225 ampA,pepA,lap, - NG1227 NG1230 NG1229 NG1228 acnB, - NG1231 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 mip,fklB, - NG1225 ampA,pepA,lap, - NG1227 NG1230 NG1229 NG1228 acnB, - NG1231
* Calculated from Protein Sequence

Gene ID: NG1227

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ampA  pepA  lap  

Definition:
cytosol aminopeptidase (leucyl aminopeptidase, LAP)

Gene Start:
1177720

Gene Stop:
1176317

Gene Length:
1404

Molecular Weight*:
49986

pI*:
4.90

Net Charge*:
-14.41

EC:
3.4.11.1  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Stirling,C.J., Colloms,S.D., Collins,J.F., Szatmari,G. and
Sherratt,D.J.
xerB, an Escherichia coli gene required for plasmid ColE1
site-specific recombination, is identical to pepA, encoding
aminopeptidase A, a protein with substantial similarity to bovine
lens leucine aminopeptidase
EMBO J. 8 (5), 1623-1627 (1989)
M:89356633

Charlier,D., Hassanzadeh,G., Kholti,A., Gigot,D., Pierard,A. and
Glansdorff,N.
carP, involved in pyrimidine regulation of the Escherichia coli
carbamoylphosphate synthetase operon encodes a sequence-specific
DNA-binding protein identical to XerB and PepA, also required for
resolution of ColEI multimers
J. Mol. Biol. 250 (4), 392-406 (1995)
M:95341674

McCulloch,R., Burke,M.E. and Sherratt,D.J.
Peptidase activity of Escherichia coli aminopeptidase A is not
required for its role in Xer site-specific recombination
Mol. Microbiol. 12 (2), 241-251 (1994)
M:94335644


Comment:
Oklahoma ID: NGO.1227c

For other 'pep' genes, see NG0158 (pepN, ampN), NG1456 (pepP), NG2020 (pepC).

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to cytosol (leucyl) aminopeptidases, e.g. residues 118-465 are 53% similar to AMPA_PSEAE (gb|AAD04821).

Residues 1-468 are 82% similar to NMA1758 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0260
COG name: Leucyl aminopeptidase
Functional Class:  E
The phylogenetic pattern of COG0260 is -----q-cEbrHujgp--inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000819 (Cytosol aminopeptidase) with a combined E-value of 2e-106.
    IPB000819A    162-171
    IPB000819B    190-228
    IPB000819C    239-254
    IPB000819D    296-338
    IPB000819E    346-361
    IPB000819F    383-430
    IPB000819G    431-445


ProDom Summary:  Protein Domain Search
Residues 118-438 are 55% similar to a (AMINOPEPTIDASE HYDROLASE LEUCINE ZINC LAP LEUCYL CYTOSOL) protein domain (PD002804) which is seen in O68822_PSEAE.



Paralogs:  Local Blast Search


NG1227 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 159 to 463 (E-value = 1.2e-158) place NG1227 in the Peptidase_M17 family which is described as Cytosol aminopeptidase family, catalytic domain (PF00883)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
32  
154
transmembrane  
276  
292
transmembrane  
345  
361

PDB Hit:
pdb|1GYT|1GYT-A E. COLI AMINOPEPTIDASE A (PEPA) 332.0 1e-91
pdb|1BLL|1BLL-E LEUCINE AMINOPEPTIDASE (E.C.3.4.11.1) COMPLEX 251.0 2e-67
pdb|1LAM|1LAM LEUCINE AMINOPEPTIDASE (UNLIGATED) 251.0 2e-67
pdb|1GYT|1GYT-A E. C

Gene Protein Sequence:
VEFSTKTEILQEQQAGAQLFVCADKAPEHNTAAHALFSALEEGQNFSDTK
IPTDNGLQAVAVVRLEKTDRAALNKAAAEAAKWAQNQETVNVDVHAFDEA
QAAAVAEAFAIAFGNAAYRFDRYKKEAKPAKFSQAVFHSAHEAAVKEALR
VAEAQVYGQSLCRDLGNAAPNECTPEFLARTAKAEAEKLGAHAKIIEKDY
IKENMGSFWSVAKGSVEDPYLVELSYFGAADKEAAPVVLVGKGITFDTGG
ISLKPGLNMDEMKFDMCGAATVISTFCAAVKLQLPINLIAIVATCENMPS
GAANKPGDVVKSMKGLTIEVLNTDAEGRLILCDALTYAEQFKPKAVIDVA
TLTGACIVALGHDVSGVMGNNQDLIDSLLAASYNVDDKAWQLPLFETYKD
QLKSNFADIPNIGTPGAGTITAATFLSYFTEGYPWAHLDIAGTAWKSGAE
KGATGRPVPLLMNYLRNL

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAATTTAGCACAAAAACCGAAATCTTGCAGGAACAGCAGGCAGGCGC
GCAGTTATTTGTCTGTGCCGACAAAGCACCCGAGCACAACACCGCCGCAC
ATGCGCTCTTCTCTGCTTTGGAAGAGGGTCAGAATTTTTCCGACACCAAA
ATCCCGACGGACAACGGTTTGCAGGCAGTCGCCGTCGTCCGCCTCGAAAA
AACCGACCGCGCCGCGCTGAACAAAGCCGCCGCCGAAGCCGCCAAATGGG
CGCAAAATCAAGAAACGGTCAATGTGGACGTTCACGCCTTTGATGAGGCG
CAAGCAGCAGCCGTTGCCGAAGCTTTTGCCATCGCGTTCGGCAACGCTGC
ATATCGTTTCGACCGCTACAAAAAAGAAGCCAAGCCCGCCAAATTTTCGC
AAGCCGTGTTCCACAGCGCACACGAAGCCGCCGTCAAAGAAGCCCTGCGC
GTTGCCGAAGCACAAGTTTACGGACAAAGCCTCTGCCGCGACTTAGGCAA
TGCCGCACCGAACGAATGCACGCCTGAGTTCCTCGCGCGTACCGCCAAAG
CCGAAGCCGAGAAACTGGGCGCGCACGCCAAAATCATCGAAAAAGACTAC
ATCAAAGAAAACATGGGTTCGTTTTGGTCGGTTGCCAAAGGCAGCGTCGA
AGACCCATATTTGGTTGAACTGAGCTATTTCGGTGCGGCCGACAAAGAAG
CCGCGCCTGTGGTATTGGTCGGCAAAGGCATTACCTTCGACACCGGCGGC
ATTTCCCTCAAACCCGGCCTGAACATGGACGAAATGAAGTTTGACATGTG
CGGCGCGGCAACCGTCATCAGCACCTTCTGCGCCGCCGTCAAACTGCAAC
TGCCGATCAATCTGATTGCCATCGTCGCCACTTGTGAAAACATGCCTTCC
GGCGCGGCAAACAAACCGGGCGATGTTGTGAAAAGTATGAAAGGGCTGAC
GATTGAAGTGTTGAACACCGATGCCGAAGGCCGTCTGATTTTGTGCGACG
CGCTCACTTACGCCGAGCAGTTCAAACCCAAAGCCGTCATCGATGTCGCC
ACCCTGACCGGCGCGTGCATCGTCGCCTTGGGGCACGATGTCAGCGGCGT
GATGGGCAATAATCAGGATTTGATCGACAGCCTGCTTGCCGCTTCCTACA
ACGTGGACGACAAAGCGTGGCAACTGCCGCTCTTTGAAACCTACAAAGAC
CAGCTCAAATCCAACTTTGCCGACATCCCCAATATCGGCACGCCCGGCGC
GGGCACGATTACCGCCGCAACATTCCTGTCCTATTTCACCGAAGGCTACC
CGTGGGCGCACCTTGACATCGCGGGTACGGCGTGGAAATCCGGAGCGGAA
AAAGGTGCGACCGGCCGCCCCGTACCGCTGCTGATGAACTATCTGCGGAA
TCTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy