Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0996 IGR0991 IGR0994 IGR0992 IGR0997 IGR0988 IGR0995 IGR0990 IGR0993 IGR0989 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 mip,fklB, - NG1225 NG1220 ampA,pepA,lap, - NG1227 NG1230 NG1229 NG1228 acnB, - NG1231 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 mip,fklB, - NG1225 NG1220 ampA,pepA,lap, - NG1227 NG1230 NG1229 NG1228 acnB, - NG1231 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 mip,fklB, - NG1225 NG1220 ampA,pepA,lap, - NG1227 NG1230 NG1229 NG1228 acnB, - NG1231
* Calculated from Protein Sequence

Gene ID: NG1226

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
holC  

Definition:
DNA polymerase III chi subunit

Gene Start:
1176251

Gene Stop:
1175814

Gene Length:
438

Molecular Weight*:
16510

pI*:
4.80

Net Charge*:
-7.13

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
DNA polymerase
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
O'Donnell,M. Accessory protein function in the DNA polymerase III holoenzyme from E. coli. Bioessays 14 (2), 105-111 (1992) Medline: 92246902.

Comment:
Oklahoma ID: NGO.1226c

From GenBANK (gi:118808): DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity. The tau chain serves as a scaffold to help in the dimerizaton of the core complex. The gamma chain seems to interact with the delta subunit to transfer the beta subunit on the DNA. The reaction: N deoxynucleoside triphosphate = N pyrophosphate + DNA(N). The enzyme contains a core (composed of alpha, epsilon, and theta chains) that associates with a tau subunit which allow the core dimerization to form the PolIII' complex. PolIII' associates with the gamma complex (composed of chains gamma, delta, delta', psi, and chi) and with the beta chain. The final composition of the complex is: (alpha,epsilon,theta)[2]-tau[2]-(gamma,delta,delta', psi,chi)[2]-beta[4]. The production of the two protein products from this region is due to programmed ribosomal frameshifting. Partial similarity to phage T4 DNA polymerase accessory protein 44 and to human activator 1, 37 and 40 kda subunits.

For a review of DNA Pol III, see O'Donnell,M. Accessory protein function in the DNA polymerase III holoenzyme from E. coli. Bioessays 14 (2), 105-111 (1992) Medline: 92246902.

For other pol III subunits, see NG0078 (alpha), NG0283 (delta), NG0347 (delta prime), NG0743 (gamma-tau), NG0973 (epsilon), NG0002 (beta).

Blast Summary:  PSI-Blast Search
Limited matches in gapped BLAST to polIII chi subunit sequences, e.g. residues 12-142 are 27% similar to the polIII subunit from Xylella fastidiosa (gb|AAF82949).

Residues 1-146 are 93% similar to NMA1757, apredicted chi chain in N.meningitidis (AL162757).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1226 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 142 (E-value = 3.6e-69) place NG1226 in the DNA_pol3_chi family which is described as DNA polymerase III chi subunit, HolC (PF04364)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPKVTFYTHVDQIPLFTCRLIARAIRDGGRILVWSDSFGRLQELDKMLWQ
YEAESFIPHEIWETEEAMPSDTSVLLACDGNLPRIPEGMAVLNLSDGFWN
TASVLPARVLEIVGNSLEDLADARERFTAYRRSGFAIEHHGMEGKA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGAAAGTTACCTTTTATACCCATGTTGACCAAATCCCCCTTTTTAC
CTGTCGGTTGATTGCGCGCGCTATCCGAGACGGCGGCAGGATACTGGTGT
GGTCCGACTCGTTCGGACGGCTTCAGGAATTGGACAAAATGCTTTGGCAA
TACGAGGCCGAGAGTTTTATTCCGCACGAAATTTGGGAAACGGAAGAAGC
CATGCCGTCTGACACATCCGTCCTGCTTGCCTGCGACGGCAATCTGCCCC
GAATTCCCGAAGGCATGGCCGTTTTGAACCTGTCCGACGGTTTTTGGAAC
ACCGCTTCGGTCTTGCCCGCGCGCGTTTTGGAAATCGTCGGCAACAGCCT
GGAAGATCTCGCCGACGCGCGCGAACGCTTTACCGCCTACCGCCGAAGCG
GTTTTGCCATCGAACATCACGGCATGGAGGGCAAGGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy