Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0996 IGR0991 IGR0987 IGR0994 IGR0992 IGR0988 IGR0995 IGR0990 IGR0993 IGR0989 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 glpR,deoR, - NG1219 mip,fklB, - NG1225 NG1220 ampA,pepA,lap, - NG1227 NG1230 NG1229 NG1228 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 glpR,deoR, - NG1219 mip,fklB, - NG1225 NG1220 ampA,pepA,lap, - NG1227 NG1230 NG1229 NG1228 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 glpR,deoR, - NG1219 mip,fklB, - NG1225 NG1220 ampA,pepA,lap, - NG1227 NG1229 NG1228 NG1230
* Calculated from Protein Sequence

Gene ID: NG1225

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mip  fklB  

Definition:
peptidyl-prolylisomerase; macrophage infectivity potentiator

Gene Start:
1175551

Gene Stop:
1174736

Gene Length:
816

Molecular Weight*:
28908

pI*:
5.60

Net Charge*:
-1.79

EC:
5.2.1.8  

Functional Class:
Cellular processes; Chaperones  
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
Ratcliff,R.M., Donnellan,S.C., Lanser,J.A., Manning,P.A. and
Heuzenroeder,M.W.
Interspecies sequence differences in the Mip protein from the genus Legionella: implications for function and evolutionary relatedness. Mol. Microbiol. 25 (6), 1149-1158 (1997)
M:98010353


Comment:
Oklahoma ID: NGO.1225c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to macrophage infectivity potentiator sequences and to peptidyl-prolyl isomerase. Residues 44-256 are 47% similar to the macrophage infectivity potentiator in Legionella londiniensis (gb|AAC45696).

Residues 1-272 are 87% similar to NMB1567, a predicted macrophage infectivity potentiator (gb|AAF41921) and to NMA1756, a predicted peptidyl-prolyl isomerase (AL162757).

COGS Summary:  COGS Search
BeTs to 5 clades of COG0545
COG name: FKBP-type peptidyl-prolyl cis-trans isomerases 1
Functional Class:  O
The phylogenetic pattern of COG0545 is ----Y--cE--h-----lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000774 (Domain amino terminal to FKBP-type peptidyl-prolyl isomerase) with a combined E-value of 1.7e-71.
    IPB000774A    121-161
    IPB000774B    172-199
    IPB000774C    200-229
    IPB000774D    237-252
***** IPB001179 (FKBP-type peptidyl-prolyl cis-trans isomerase (PPIase)) with a combined E-value of 9.6e-12.
    IPB001179    196-229


ProDom Summary:  Protein Domain Search
Residues 43-155 are 43% similar to a (MACROPHAGE INFECTIVITY POTENTIATOR) protein domain (PD001516) which is seen in O32767_BBBBB.

Residues 157-252 are 56% similar to a (PROTEIN ISOMERASE CIS-TRANS PPIASE PEPTIDYL-PROLYL) protein domain (PD000420) which is seen in Q53327_LEGMI.



Paralogs:  Local Blast Search


NG1225 is paralogously related to NG2092 (ferric enterobactin periplasmic binding protein, possible ABC solute binding protein) (3e-04).


Pfam Summary:  Pfam Search
Residues 26 to 155 (E-value = 3e-31) place NG1225 in the FKBP_N family which is described as Domain amino terminal to FKBP-type peptidyl-prolyl isomerase (PF01346)
Residues 159 to 250 (E-value = 8.8e-43) place NG1225 in the FKBP_C family which is described as FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254)

Structural Feature(s):
Feature Type  Start  Stop
may be a lipoprotein  
  
gram negative signal  
1  
26
coil-coil  
89  
127

PDB Hit:
pdb|1FD9|1FD9-A CRYSTAL STRUCTURE OF THE MACROPHAGE INFECTIVITY 190.0 2e-49
pdb|1JVW|1JVW-A TRYPANOSOMA CRUZI MACROPHAGE INFECTIVITY 103.0 4e-23
pdb|1YAT|1YAT FK-506 BINDING PROTEIN (12 KD, YEAST) COMPLEX 69.9 5e-13
pdb|1FKK|1FKK ATOMI

Gene Protein Sequence:
MNTIFKISALTLSAALALSACGKKEAAPASASEPAAASAAQGDTSSIGST
MQQASYAMGVDIGRSLKQMKEQGAEIDLKVFTDAMQAVYDGKEIKMTEEQ
AQEVMMKFLQEQQAKAVEKHKADAKANKEKGEAFLKENAAKDGVKTTASG
LQYKITKQGEGKQPTKDDIVTVEYEGRLIDGTVFDSSKANGGPATFPLSQ
VIPGWTEGVRLLKEGGEATFYIPSNLAYREQGAGEKIGPNATLVFDVKLV
KIGAPENAPAKQPDQVDIKKVN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACACCATTTTCAAAATCAGCGCACTGACCCTTTCCGCCGCTTTGGC
ACTTTCCGCCTGCGGCAAAAAAGAAGCCGCCCCCGCATCTGCATCCGAAC
CTGCCGCCGCTTCTGCCGCGCAGGGCGACACCTCTTCAATCGGCAGCACG
ATGCAGCAGGCAAGCTATGCAATGGGCGTGGACATCGGACGCTCCCTGAA
ACAAATGAAGGAACAGGGCGCGGAAATCGATTTGAAAGTCTTTACCGATG
CCATGCAGGCAGTGTATGACGGCAAAGAAATCAAAATGACCGAAGAGCAG
GCCCAGGAAGTGATGATGAAATTCCTGCAGGAGCAGCAGGCTAAAGCCGT
AGAAAAACACAAGGCGGATGCGAAGGCCAACAAAGAAAAAGGCGAAGCCT
TCCTGAAGGAAAATGCCGCCAAAGACGGCGTGAAGACCACTGCTTCCGGT
CTGCAGTACAAAATCACCAAACAGGGTGAAGGCAAACAGCCGACAAAAGA
CGACATCGTTACCGTGGAATACGAAGGCCGCCTGATTGACGGTACCGTAT
TCGACAGCAGCAAAGCCAACGGCGGCCCGGCCACCTTCCCTTTGAGCCAA
GTGATTCCGGGTTGGACCGAAGGCGTACGGCTTCTGAAAGAAGGCGGCGA
AGCCACGTTCTACATCCCGTCCAACCTTGCCTACCGCGAACAGGGTGCGG
GCGAAAAAATCGGTCCGAACGCCACTTTGGTATTTGACGTGAAACTGGTC
AAAATCGGCGCACCCGAAAACGCGCCCGCCAAGCAGCCGGATCAAGTCGA
CATCAAAAAAGTAAAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy