Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0991 IGR0987 IGR0994 IGR0986 IGR0992 IGR0988 IGR0995 IGR0990 IGR0993 IGR0989 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 glpR,deoR, - NG1219 mip,fklB, - NG1225 NG1220 ampA,pepA,lap, - NG1227 glnS,glnRS, - NG1218 NG1229 NG1228 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 glpR,deoR, - NG1219 mip,fklB, - NG1225 NG1220 ampA,pepA,lap, - NG1227 glnS,glnRS, - NG1218 NG1229 NG1228 NG1222 holC, - NG1226 purN, - NG1224 NG1223 gntR,mdcY, - NG1221 glpR,deoR, - NG1219 mip,fklB, - NG1225 NG1220 ampA,pepA,lap, - NG1227 glnS,glnRS, - NG1218 NG1228 NG1229
* Calculated from Protein Sequence

Gene ID: NG1224

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
purN  

Definition:
phosphoribosylglycinamide formyltransferase

Gene Start:
1174626

Gene Stop:
1174003

Gene Length:
624

Molecular Weight*:
22357

pI*:
6.20

Net Charge*:
-3.51

EC:
2.1.2.2  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
One carbon pool by folate
Purine metabolism

Secondary Evidence:
Inglese,J., Smith,J.M. and Benkovic,S.J.
Active-site mapping and site-specific mutagenesis of glycinamide
ribonucleotide transformylase from Escherichia coli
Biochemistry (N.Y.) 29 (28), 6678-6687 (1990)
M:90373777

Chen,P., Schulze-Gahmen,U., Stura,E.A., Inglese,J., Johnson,D.L.,
Marolewski,A., Benkovic,S.J. and Wilson,I.A.
Crystal structure of glycinamide ribonucleotide transformylase from Escherichia coli at 3.0 A resolution. A target enzyme for
chemotherapy
J. Mol. Biol. 227 (1), 283-292 (1992)
M:92395668

Almassy,R.J., Janson,C.A., Kan,C.C. and Hostomska,Z.
Structures of apo and complexed Escherichia coli glycinamide
ribonucleotide transformylase
Proc. Natl. Acad. Sci. U.S.A. 89 (13), 6114-6118 (1992)
M:92335248

Su,Y., Yamashita,M.M., Greasley,S.E., Mullen,C.A., Shim,J.H.,
Jennings,P.A., Benkovic,S.J. and Wilson,I.A.
A pH-dependent stabilization of an active site loop observed from
low and high pH crystal structures of mutant monomeric glycinamide
ribonucleotide transformylase at 1.8 to 1.9 A
J. Mol. Biol. 281 (3), 485-499 (1998)
M:98365514

Greasley,S.E., Yamashita,M.M., Cai,H., Benkovic,S.J., Boger,D.L.
and Wilson,I.A.
New insights into inhibitor design from the crystal structure and
NMR studies of Escherichia coli GAR transformylase in complex with
beta-GAR and 10-formyl-5,8,10-trideazafolic acid
Biochemistry (N.Y.) 38 (51), 16783-16793 (1999)
M:20074527


Comment:
Oklahoma ID: NGO.1224c

For other 'pur' genes, see NG0333 (purC), NG0398 (purA), NG0526 (purM), NG0748 (purE), NG0875 (purK), NG1183 (purL), NG0263 (purF), NG1466 (purH), NG1711 (purB), NG1939 (purD)

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to phosphoribosylglycinamide formyltransferase sequences. Residues 3-187 are 52% similar to the enzyme from P.aeruginosa (gb|AAG04333).

Residues 1-208 are virtually identical to NMA1755 from N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 7 clades of COG0299
COG name: Folate-dependent phosphoribosylglycinamide formyltransferase PurN
Functional Class:  F
The phylogenetic pattern of COG0299 is ----yqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 4-179 are 53% similar to a (TRANSFERASE PROTEIN FORMYLTRANSFERASE BIOSYNTHESIS) protein domain (PD001209) which is seen in P74882_SALTY.



Paralogs:  Local Blast Search


NG1224 is paralogously related to NG1870 (methionyl-tRNA formyltransferase) (1e-07).


Pfam Summary:  Pfam Search
Residues 2 to 179 (E-value = 1.5e-67) place NG1224 in the Formyl_trans_N family which is described as Formyl transferase (PF00551)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
80  
96

PDB Hit:
pdb|2GAR|2GAR A PH-DEPENDENT STABLIZATION OF AN ACTIVE SITE 197.0 2e-51
pdb|1C2T|1C2T-A NEW INSIGHTS INTO INHIBITOR DESIGN FROM THE 195.0 6e-51
pdb|1C3E|1C3E-A NEW INSIGHTS INTO INHIBITOR DESIGN FROM THE 195.0 6e-51
pdb|1MEJ|1MEJ-B HUMA

Gene Protein Sequence:
MKNIVILISGRGSNMQAIVNAAIPNVRIAAVLSNSETAAGLQWAAERGIP
TDSLNHKNFESRLAFDTAMMEKIDAYQPDLVVLAGFMRILTPEFCAHYEG
RLMNIHPSILPSFTGLHTHERALEAGCRVAGCTIHFVTAELDCGPIVSQG
IVPILDGDTADDVAARVLAVEHKLYPKAVADVAAGRLIIEGNRVRNSENA
DAARFLTA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAACATCGTCATCCTGATTTCCGGACGCGGCAGCAATATGCAGGC
AATCGTCAATGCCGCCATTCCCAACGTCCGCATTGCCGCCGTGTTGAGCA
ACAGCGAAACGGCTGCCGGTTTGCAATGGGCGGCCGAACGCGGCATCCCG
ACCGACAGCCTGAATCATAAAAACTTTGAATCACGACTTGCCTTCGATAC
GGCCATGATGGAAAAAATCGACGCATATCAACCCGATTTGGTGGTTTTGG
CAGGTTTTATGCGGATTCTGACCCCTGAGTTCTGCGCCCATTACGAAGGC
AGGCTGATGAACATCCATCCGTCCATCCTGCCCTCGTTCACCGGGCTTCA
TACGCACGAACGCGCTTTGGAAGCAGGTTGCCGCGTTGCCGGCTGTACGA
TTCATTTCGTTACGGCCGAGCTGGATTGCGGCCCGATTGTATCGCAAGGG
ATTGTGCCGATACTTGACGGCGATACGGCAGACGATGTTGCCGCCCGGGT
TTTGGCTGTCGAACACAAACTCTATCCGAAAGCCGTTGCCGATGTTGCCG
CCGGCCGCCTGATTATCGAGGGAAACCGTGTCAGAAATTCGGAAAACGCC
GATGCCGCCCGTTTCCTGACGGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy