Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0987 IGR0981 IGR0982 IGR0986 IGR0985 IGR0983 IGR0988 IGR0984 IGR0990 IGR0989 NG1222 dagK, - NG1216 NG1215 NG1223 gntR,mdcY, - NG1221 glpR,deoR, - NG1219 NG1220 gshB,gsh-II, - NG1217 trmU, - NG1214 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218 NG1222 dagK, - NG1216 NG1215 NG1223 gntR,mdcY, - NG1221 glpR,deoR, - NG1219 NG1220 gshB,gsh-II, - NG1217 trmU, - NG1214 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218 dagK, - NG1216 NG1215 NG1223 gntR,mdcY, - NG1221 glpR,deoR, - NG1219 NG1220 gshB,gsh-II, - NG1217 trmU, - NG1214 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218 NG1222
* Calculated from Protein Sequence

Gene ID: NG1218

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glnS  glnRS  

Definition:
glutaminyl-tRNA synthetase

Gene Start:
1169589

Gene Stop:
1167871

Gene Length:
1719

Molecular Weight*:
65765

pI*:
6.40

Net Charge*:
-7.49

EC:
6.1.1.18  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glutamate metabolism

Secondary Evidence:
Uemura,H., Conley,J., Yamao,F., Rogers,J. and Soll,D.
Escherichia coli glutaminyl-tRNA synthetase: a single amino acid
replacement relaxes rRNA specificity
Protein Seq. Data Anal. 1 (6), 479-485 (1988)
Medline: 89113343

Yamao,F., Inokuchi,H., Cheung,A., Ozeki,H. and Soll,D.
Escherichia coli glutaminyl-tRNA synthetase. I. Isolation and DNA
sequence of the glnS gene
J. Biol. Chem. 257 (19), 11639-11643 (1982)
Medline: 89113343



Comment:
Oklahoma ID: NGO.1218c

For other 'gln' genes, see NG0269 (glnQ), NG0374 (glnQ), NG0798 (glnD), NG1182 (glnB), NG2011 (glnM), NG1600 (glnA), NG1758
(glnE), NG2013 (glnQ), NG2012 (glnP).

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to glutaminyl-tRNA synthetases, e.g. residues 12-570 are 61% similar to the enzyme from P.aeruginosa (gb|AAG05183).

Residues 1-573 are virtually identical to NMA1748 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0008
COG name: Glutamyl- and glutaminyl-tRNA synthetases
Functional Class:  J
The phylogenetic pattern of COG0008 is amtkYqVcEbrHUJgpolinX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 414-568 are 39% similar to a (PROTEIN GLUTAMINYL-TRNA SYNTHETASE) protein domain (PD017811) which is seen in O62431_CAEEL.

Residues 40-324 are 71% similar to a (SYNTHETASE GLUTAMYL-TRNA PROTEIN AMINOACYL-TRNA LIGASE) protein domain (PD001595) which is seen in SYQ_ECOLI.

Residues 347-560 are 47% similar to a (SYNTHETASE PROTEIN AMINOACYL-TRNA LIGASE BIOSYNTHESIS) protein domain (PD004693) which is seen in SYQ_ECOLI.



Paralogs:  Local Blast Search


NG1218 is paralogously related to NG1926 (glutamyl-tRNA synthetase (GltX)) (7e-12) and NG1611 (glutaminyl-tRNA synthetase) (4e-05).


Pfam Summary:  Pfam Search
Residues 39 to 352 (E-value = 7.7e-145) place NG1218 in the tRNA-synt_1c family which is described as tRNA synthetases class I (E and Q), catalytic domain (PF00749)
Residues 354 to 549 (E-value = 6.1e-101) place NG1218 in the tRNA-synt_1c_C family which is described as tRNA synthetases class I (E and Q), anti-codon binding domain (PF03950)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1QRT|1QRT-A GLUTAMINYL-TRNA SYNTHETASE MUTANT D235G 691.0 0.000000
pdb|1GSG|1GSG-P GLUTAMINYL-T/RNA$ SYNTHETASE (GLN/RS$) COMPLEX 690.0 0.000000
pdb|1QRS|1QRS-A GLUTAMINYL-TRNA SYNTHETASE MUTANT D235N 690.0 0.000000
pdb|1QRU|1QRU-A

Gene Protein Sequence:
MPSEAICLKKTMLNKDQFADNHFIRTIIEDDLKSGKHEAVQTRFPPEPNG
YLHIGHAKSICLNFGLAYIYDGLCNLRFDDTNPEKENDEYVNAIKEDVEW
LGFHWAGEPRFASDYFDRLYDYAVGLIKDGKAYVDDLTPEEMREYRGTLT
EAGKNSPYRDRSIEENLDLFTRMKNGEFPDGSKTLRLKIDMAAGNINMRD
PVIYRIRRAHHHNTGDKWCIYPMYDYTHCISDAIEGITHSLCTLEFEAHR
PLYDWVLDNIPALHATRPRQYEFSRLELLYTITSKRKLNQLVVEKHVSGW
DDPRMPTISGMRRRGYTPEGVRLFAKRAGISKSENIVDMSVLEGAIREEL
ENSAPRLMAVLNPLKVTLTNFQAGKTQSRRAAFHPNHEEMGDREVPVSQT
IYIEADDFAENPPKGFKRLIPGGEVRLRHGYVIKCGEVVKDEAGNVVELK
CSIDHDTLGKNPEGRKVKGVIHWVSAEHAAEIKVRLYDRLFTVERPGAVR
GEDGEYLPFTDFLNPESVKEITAYAEPAAKDLPAESRWQFERIGYFVTDR
QDHGKDTPVFNRTVTLKDSWQPK

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGTCTGAAGCCATCTGTTTAAAGAAAACCATGCTCAATAAAGACCA
ATTCGCGGACAACCATTTCATCCGCACCATCATCGAAGACGACCTCAAAA
GCGGCAAACACGAAGCCGTCCAAACCCGTTTTCCGCCCGAACCCAACGGC
TATTTACATATCGGACACGCCAAATCCATCTGCCTGAACTTCGGTTTGGC
GTATATTTACGACGGTTTGTGCAACCTGCGTTTCGACGACACCAACCCCG
AAAAAGAAAACGACGAATACGTCAACGCCATCAAAGAAGATGTCGAGTGG
CTCGGTTTCCATTGGGCGGGCGAGCCGCGTTTCGCTTCCGACTATTTCGA
CCGGCTTTATGACTACGCCGTCGGTTTAATCAAAGACGGCAAAGCGTATG
TCGATGATTTGACGCCCGAAGAAATGCGAGAATACCGCGGTACGCTGACC
GAAGCGGGTAAAAACAGCCCTTACCGCGACCGCAGTATCGAAGAAAACCT
CGACCTGTTCACGCGTATGAAAAACGGCGAGTTCCCCGACGGCAGCAAAA
CCCTGCGCCTGAAAATCGACATGGCGGCAGGCAACATCAATATGCGCGAT
CCCGTCATCTACCGCATCCGCCGCGCCCATCACCATAACACCGGCGACAA
ATGGTGCATCTACCCGATGTACGATTACACGCATTGCATTTCCGATGCCA
TCGAAGGCATCACGCATTCCTTGTGCACGCTCGAATTTGAAGCGCACCGT
CCGCTTTACGACTGGGTGTTGGACAACATCCCCGCGCTGCACGCCACCCG
TCCGCGCCAATACGAGTTTTCCCGTTTGGAGCTTTTGTACACCATTACCT
CCAAACGGAAATTGAATCAGTTGGTTGTGGAAAAACACGTTTCCGGCTGG
GATGATCCGCGTATGCCGACCATTTCCGGTATGCGCCGCCGCGGCTACAC
GCCCGAAGGGGTGCGCCTGTTTGCCAAACGCGCCGGTATTTCCAAATCTG
AAAACATCGTCGACATGAGCGTGTTGGAGGGTGCGATTCGCGAAGAGCTG
GAAAACTCCGCCCCGCGCCTGATGGCGGTTTTGAACCCGCTCAAAGTGAC
CCTGACCAACTTTCAAGCCGGCAAAACCCAAAGCCGCCGTGCCGCGTTCC
ATCCGAACCACGAAGAAATGGGCGATCGCGAAGTACCTGTTTCACAAACC
ATCTACATCGAAGCCGACGACTTTGCCGAAAATCCGCCCAAAGGCTTCAA
GCGTCTGATTCCCGGCGGCGAAGTACGCTTGCGCCACGGCTATGTCATCA
AGTGCGGTGAAGTCGTCAAAGACGAAGCAGGCAATGTGGTTGAACTCAAA
TGCAGCATCGACCACGACACCTTGGGCAAAAATCCAGAAGGCCGCAAAGT
TAAAGGCGTGATTCACTGGGTTTCCGCCGAACACGCCGCCGAAATCAAAG
TCCGTCTGTACGACCGCCTCTTTACCGTCGAGCGTCCCGGTGCCGTGCGC
GGCGAAGACGGCGAATACCTGCCGTTTACCGATTTCCTCAATCCGGAATC
CGTTAAGGAAATCACTGCTTACGCCGAACCTGCCGCGAAAGATTTGCCGG
CGGAAAGCCGTTGGCAGTTCGAGCGTATCGGCTATTTTGTGACCGACCGC
CAAGACCACGGCAAAGACACGCCGGTGTTTAACCGCACGGTGACGTTGAA
AGATTCTTGGCAGCCTAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy