Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0987 IGR0981 IGR0982 IGR0986 IGR0985 IGR0980 IGR0983 IGR0988 IGR0984 dagK, - NG1216 NG1215 glpR,deoR, - NG1219 NG1220 gshB,gsh-II, - NG1217 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218 dagK, - NG1216 NG1215 glpR,deoR, - NG1219 NG1220 gshB,gsh-II, - NG1217 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218 dagK, - NG1216 NG1215 glpR,deoR, - NG1219 NG1220 gshB,gsh-II, - NG1217 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218
* Calculated from Protein Sequence

Gene ID: NG1216

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dagK  

Definition:
diacylglycerol kinase

Gene Start:
1166661

Gene Stop:
1166281

Gene Length:
381

Molecular Weight*:
13767

pI*:
8.40

Net Charge*:
1.42

EC:
2.7.1.107  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Lightner,V.A., Bell,R.M. and Modrich,P.
The DNA sequences encoding plsB and dgk loci of Escherichia coli. J. Biol. Chem. 258 (18), 10856-10861 (1983)
M:83291031

Smith,R.L., O'Toole,J.F., Maguire,M.E. and Sanders,C.R. 2nd.
Membrane topology of Escherichia coli diacylglycerol kinase. J. Bacteriol. 176 (17), 5459-5465 (1994)
M: 94350829


Comment:
Oklahoma ID: NGO.1216c

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to diacylglyceerol kinase sequences. Residues 1-106 are 44% similar to the enzyme in P.aeruginosa (gb|AAG06991).

Residues 1-106 are virtually identical to NMA1746 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 4 clades of COG0818
COG name: Diacylglycerol kinase
Functional Class:  M
The phylogenetic pattern of COG0818 is ------vceb-huj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000829 (Prokaryotic diacylglycerol kinase) with a combined E-value of 3.5e-51.
    IPB000829A    18-62
    IPB000829B    63-109


ProDom Summary:  Protein Domain Search
Residues 16-106 are 41% similar to a (DIACYLGLYCEROL KINASE DAGK DIGLYCERIDE) protein domain (PD010722) which is seen in KDGL_HAEIN.



Paralogs:  Local Blast Search


NG1216 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 127 (E-value = 2.4e-22) place NG1216 in the DAGK_prokar family which is described as Prokaryotic diacylglycerol kinase (PF01219)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
31  
127
transmembrane  
43  
59
transmembrane  
61  
77
transmembrane  
111  
127

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MEPSSYAAEKKGKSGIRRVINAFGYSIDGIAAAYRYEVAFRQVLWLNALL
VCAAFFWVSETAVRLPLIIASFVSVIVELFNTAVEAAVDHTSTEKHELAK
RAKDAGSAAQLVAMLMLAAVWLSALFG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACCTTCCTCCTACGCGGCAGAAAAAAAAGGCAAAAGCGGCATCAG
GCGCGTCATCAACGCATTCGGCTATTCGATAGACGGCATCGCCGCCGCCT
ACCGTTACGAAGTGGCATTCCGTCAGGTTTTGTGGCTGAACGCGCTGCTG
GTGTGCGCGGCATTTTTTTGGGTTTCCGAAACCGCCGTCCGCCTGCCGTT
GATTATCGCGTCTTTTGTGTCGGTCATTGTCGAACTGTTCAACACCGCCG
TCGAAGCCGCCGTCGATCATACTTCGACCGAAAAACACGAGCTGGCCAAA
CGCGCCAAAGATGCAGGTTCTGCCGCACAACTGGTTGCCATGCTGATGTT
GGCGGCGGTTTGGCTGTCCGCCCTGTTCGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy