Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0978 IGR0981 IGR0982 IGR0986 IGR0985 IGR0980 IGR0983 IGR0979 IGR0984 dagK, - NG1216 NG1215 tpn, - NG1211 glpR,deoR, - NG1219 gshB,gsh-II, - NG1217 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218 NG1210 dagK, - NG1216 NG1215 tpn, - NG1211 glpR,deoR, - NG1219 gshB,gsh-II, - NG1217 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218 NG1210 dagK, - NG1216 NG1215 tpn, - NG1211 glpR,deoR, - NG1219 gshB,gsh-II, - NG1217 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218 NG1210
* Calculated from Protein Sequence

Gene ID: NG1214

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trmU  

Definition:
tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase

Gene Start:
1165596

Gene Stop:
1164448

Gene Length:
1149

Molecular Weight*:
42782

pI*:
6.70

Net Charge*:
-1.16

EC:
2.1.1.61  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Secondary Evidence:
He,B., Smith,J.M. and Zalkin,H.
Escherichia coli purB gene: cloning, nucleotide sequence, and regulation by purR
J. Bacteriol. 174 (1), 130-136 (1992)
M:92104952


Comment:
Oklahoma ID: NGO.1214c

For other 'trm' genes, see NG0819 (trmH), NG0172 (trmD), NG1330 (trmA).

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase sequences. Residues 20-376 are 55% similar to the enzyme from P.aeruginosa (gb|AAG06014).

Residues 1-383 are 91% similar to NMA1744 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0482
COG name: Predicted ATPase of the PP-family
Functional Class:  R
The phylogenetic pattern of COG0482 is ----yQvcebrhUJgpo-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003694 (NAD+ synthase) with a combined E-value of 2.5e-08.
    IPB003694A    27-46
    IPB003694C    159-195
***** IPB000541 (Uncharacterized protein family UPF0021) with a combined E-value of 2.2e-07.
    IPB000541B    24-42
    IPB000541D    125-163


ProDom Summary:  Protein Domain Search
Residues 116-372 are 57% similar to a (TRNA) protein domain (PD005022) which is seen in TRMU_ECOLI.

Residues 26-115 are 55% similar to a (PROTEIN SYNTHETASE LIGASE BIOSYNTHESIS PROBABLE) protein domain (PD000352) which is seen in TRMU_ECOLI.



Paralogs:  Local Blast Search


NG1214 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 24 to 372 (E-value = 6.3e-198) place NG1214 in the tRNA_Me_trans family which is described as tRNA methyl transferase (PF03054)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
74  
90

PDB Hit:
pdb|1GPM|1GPM-A ESCHERICHIA COLI GMP SYNTHETASE COMPLEXED WITH 76.1 1e-14

Gene Protein Sequence:
VLKSAFKNRRFQAILRMNTTSNTSNIIVGLSGGVDSSVTAALLKQQGYQV
RGVFMQNWENDDNDEYCSIKQDSFDAIAVADIVGIDIDIVNFAAQYKDKV
FAYFLQEYSAGRTPNPDVLCNAEIKFKCFLDYAVGQGADTIATGHYARKE
ARNGVHYLLKGLDRNKDQSYFLYRLKPFQLERAIFPLGGLEKPEVRRLAA
EFNLPTAAKKDSTGICFIGERPFREFLQKYLPTDNGKMVTPEGKTIGEHV
GLMFYTLGQRKGLGIGGAGEPWFVAAKDLTKNELIVVQGHDHPLLYTRSL
VMNDLSFTLPERPKAGRYTCKTRYRMADAPCELCYLDDETAELVFDEPQW
AVTPGQSAVLYDVDICLGGGIIQTTDKPVIITR

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTAAAATCCGCCTTTAAAAACCGCCGTTTCCAAGCCATCCTGCGTAT
GAATACGACATCAAACACTTCCAATATCATCGTCGGGCTTTCCGGCGGTG
TCGATTCTTCCGTAACCGCCGCCCTGCTCAAGCAGCAGGGTTATCAAGTG
CGCGGTGTGTTCATGCAGAACTGGGAAAACGACGACAACGACGAATATTG
CAGCATCAAACAGGATTCGTTCGATGCCATCGCCGTTGCCGATATTGTCG
GCATCGACATCGACATCGTTAATTTCGCCGCGCAATATAAAGACAAAGTT
TTTGCTTATTTTCTTCAGGAATACAGTGCGGGGCGCACGCCGAATCCGGA
TGTGTTGTGCAATGCCGAAATCAAATTCAAATGCTTTTTGGACTACGCCG
TAGGGCAGGGCGCGGATACCATTGCCACCGGACACTATGCGCGCAAAGAA
GCCCGCAACGGCGTGCATTACCTGCTCAAAGGTTTGGATCGAAACAAAGA
CCAAAGCTATTTTCTCTACCGCCTCAAGCCTTTCCAACTCGAACGCGCGA
TTTTTCCGTTGGGCGGTTTGGAAAAACCCGAAGTGCGCCGCCTTGCCGCC
GAATTTAATTTGCCGACTGCCGCTAAAAAAGACAGTACCGGCATCTGTTT
CATCGGCGAGCGTCCGTTCCGCGAGTTTCTGCAGAAATACTTGCCGACCG
ACAACGGCAAAATGGTGACGCCCGAAGGGAAAACCATCGGCGAACACGTC
GGGCTGATGTTTTACACATTGGGTCAGCGCAAAGGATTGGGCATCGGCGG
CGCGGGCGAACCGTGGTTTGTTGCGGCTAAAGATTTGACGAAAAACGAAC
TCATCGTCGTACAAGGACACGACCATCCGCTGCTCTATACCCGCAGCCTT
GTGATGAACGATTTGAGTTTCACGCTGCCCGAACGTCCGAAGGCAGGACG
CTATACCTGCAAAACGCGTTACCGTATGGCGGACGCGCCTTGCGAATTGT
GCTATTTGGATGATGAAACCGCCGAGCTGGTGTTTGACGAACCGCAATGG
GCGGTTACGCCGGGTCAGTCCGCCGTGCTGTACGACGTCGACATCTGTTT
GGGCGGCGGCATCATCCAAACGACCGACAAACCCGTCATCATCACGCGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy