Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0978 IGR0981 IGR0982 IGR0985 IGR0977 IGR0980 IGR0983 IGR0979 IGR0984 dagK, - NG1216 NG1215 tpn, - NG1211 gshB,gsh-II, - NG1217 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218 NG1210 NG1209 dagK, - NG1216 NG1215 tpn, - NG1211 gshB,gsh-II, - NG1217 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218 NG1210 NG1209 dagK, - NG1216 NG1215 tpn, - NG1211 gshB,gsh-II, - NG1217 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 glnS,glnRS, - NG1218 NG1210 NG1209
* Calculated from Protein Sequence

Gene ID: NG1213

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fadD  lfcA  

Definition:
long-chain-fatty-acid--CoA-ligase

Gene Start:
1164374

Gene Stop:
1162707

Gene Length:
1668

Molecular Weight*:
61420

pI*:
8.90

Net Charge*:
7.45

EC:
6.2.1.3  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid metabolism

Secondary Evidence:
Fulda,M., Heinz,E. and Wolter,F.P.
The fadD gene of Escherichia coli K12 is located close to rnd at
39.6 min of the chromosomal map and is a new member of the
AMP-binding protein family.
Mol. Gen. Genet. 242 (3), 241-249 (1994)
M:94150456


Comment:
Oklahoma ID: NGO.1213c

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to long-chain-fatty-acid--CoA ligase, e.g. residues 1-552 are 53% similar to the enzyme from V.cholerae (gb|AAF95133).

Residues 1-556 are 92% similar to NMB1555 in N.meningitidis (gb|AAF41909).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0318
COG name: Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II
Functional Class:  I
The phylogenetic pattern of COG0318 is A-t-Y---EBRh------inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000873 (AMP-dependent synthetase and ligase) with a combined E-value of 5e-07.
    IPB000873A    213-228
    IPB000873B    251-261


ProDom Summary:  Protein Domain Search
Residues 303-361 are 64% similar to a (LIGASE SYNTHETASE PROTEIN ENZYME BIOSYNTHESIS ANTIBIOTIC) protein domain (PD000284) which is seen in O05174_XANCA.

Residues 100-162 are 55% similar to a (LIGASE LONG-CHAIN-FATTY-ACID--COA LONG-CHAIN ACYL-COA) protein domain (PD021808) which is seen in LCFA_ECOLI.

Residues 16-98 are 53% similar to a (LIGASE SYNTHETASE PROTEIN ENZYME BIOSYNTHESIS) protein domain (PD000102) which is seen in LCFA_ECOLI.

Residues 184-295 are 48% similar to a (LIGASE SYNTHETASE PROTEIN ENZYME) protein domain (PD000070) which is seen in O05174_XANCA.

Residues 390-445 are 64% similar to a (LIGASE SYNTHETASE PROTEIN ENZYME ANTIBIOTIC BIOSYNTHESIS) protein domain (PD000107) which is seen in LCFA_ECOLI.

Residues 462-525 are 64% similar to a (LIGASE SYNTHETASE PROTEIN ENZYME BIOSYNTHESIS ANTIBIOTIC) protein domain (PD000081) which is seen in LCFA_ECOLI.



Paralogs:  Local Blast Search


NG1213 is paralogously related to NG0530 (long-chain-fatty-acid--CoA ligase (acyl-CoA ligase) (long-chain acyl-CoA synthetase)) (2e-55).


Pfam Summary:  Pfam Search
Residues 50 to 486 (E-value = 2.8e-122) place NG1213 in the AMP-binding family which is described as AMP-binding enzyme (PF00501)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
84  
100
transmembrane  
253  
269

PDB Hit:
pdb|1BA3|1BA3 FIREFLY LUCIFERASE IN COMPLEX WITH BROMOFORM 158.0 3e-39
pdb|1MD9|1MD9-A CRYSTAL STRUCTURE OF DHBE IN COMPLEX WITH DHB 129.0 1e-30
pdb|1AMU|1AMU-A PHENYLALANINE ACTIVATING DOMAIN OF GRAMICIDIN 77.6 5e-15
pdb|1MD9|1MD9-A CRYS

Gene Protein Sequence:
MEKIWLESYEKGVSAEIDITQYNSVSDVFRQSVEKFARLPAFQNMGKTLT
YAETGKLATDFASYLQNVLKLPRGERVAIMMPNVLQYPIALFGILQAGLV
AVNTNPLYTPRELEHQLKDSGATAIIVLENFANTLELVLPRTQIKHVIVA
SVGEMFGLLKGSLINFIIRKIKKMVPEYRIRETVSFQTALKEGAKHVFQP
VALNREDTALLQYTGGTTGVARGAVLSHGNICANMLQAKEWIKNQLREGK
ETVIAALPLYHIFALTVNLMIFANAGSKIVLIANPRDMKGFIGELKKQRV
NVFIGVNTLFNAMVNRPDFAEVDFSGLRLTLGGGMATQKAVAEKWKKITG
TPIVEAYGLTEASPGVCCNPLNIESYSGSIGLPVPSTEVELRDANGKEVP
VGQPGELWVKGPQVMQGYWNRPEETAKAIDACGFLETGDIAVMDEKGRLK
LVDRKKDLVVVSGFNVYPNEIEEFIAHHEKVMEVACIGVPNEKTGEALKV
FVVKKDPSLTKEELTAFCRTGLTAYKVPKDIEFRDELPKSNVGKILRREL
RQSAGK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAAATCTGGTTAGAAAGCTACGAGAAGGGCGTCAGTGCCGAAAT
CGACATCACGCAATACAATTCCGTCAGCGACGTATTCCGCCAAAGCGTGG
AAAAATTTGCCCGTCTGCCCGCTTTTCAAAATATGGGCAAAACGCTCACT
TATGCCGAAACCGGCAAACTGGCGACCGATTTCGCCTCTTATCTGCAAAA
CGTCCTCAAGCTGCCGCGCGGCGAACGTGTTGCCATTATGATGCCGAACG
TATTGCAATATCCGATTGCCCTTTTCGGTATTTTGCAGGCAGGTTTGGTG
GCGGTGAACACCAATCCGCTCTATACGCCGCGCGAGTTGGAGCATCAGCT
GAAAGACAGCGGTGCGACCGCCATCATCGTTTTGGAAAATTTCGCCAACA
CGCTGGAGCTGGTGCTGCCGCGCACGCAGATCAAACACGTCATCGTCGCC
TCCGTCGGCGAAATGTTCGGGCTGCTTAAAGGTTCGCTGATCAATTTCAT
CATCCGAAAAATCAAGAAAATGGTTCCCGAATACCGTATTCGGGAAACCG
TTTCCTTTCAGACGGCATTGAAAGAGGGGGCGAAGCACGTTTTCCAACCT
GTCGCATTAAACCGCGAAGATACCGCATTGTTGCAATACACGGGCGGCAC
GACAGGCGTTGCCAGAGGCGCGGTGCTGAGCCACGGCAACATCTGCGCCA
ATATGCTTCAGGCAAAAGAATGGATTAAAAACCAATTGCGCGAGGGAAAA
GAAACCGTTATCGCCGCCCTGCCGCTGTACCACATCTTCGCCCTGACAGT
GAATCTGATGATTTTTGCCAATGCCGGCTCGAAAATTGTCCTGATTGCCA
ACCCGCGCGATATGAAAGGCTTTATCGGCGAACTGAAAAAGCAGCGGGTT
AACGTATTTATCGGCGTGAACACGCTGTTTAACGCGATGGTCAACCGGCC
CGATTTCGCCGAAGTCGATTTTTCAGGATTGCGGCTGACTTTGGGCGGCG
GTATGGCGACCCAAAAAGCCGTTGCCGAAAAATGGAAAAAAATCACCGGC
ACGCCCATCGTCGAAGCCTACGGTTTGACCGAAGCCAGCCCCGGCGTGTG
CTGCAACCCCTTAAACATCGAATCATACAGCGGCAGCATCGGTTTGCCCG
TCCCGTCCACCGAAGTCGAACTGCGCGACGCAAACGGCAAAGAAGTCCCC
GTTGGGCAGCCGGGCGAATTGTGGGTAAAAGGCCCGCAAGTGATGCAAGG
CTACTGGAACCGCCCCGAAGAAACCGCCAAAGCCATAGACGCGTGCGGCT
TTTTGGAAACCGGCGATATTGCCGTGATGGACGAAAAAGGCCGTCTGAAG
CTGGTCGATCGCAAAAAAGACCTCGTCGTCGTTTCCGGATTCAATGTTTA
TCCGAACGAAATCGAGGAATTCATCGCGCACCACGAAAAAGTTATGGAAG
TTGCGTGTATCGGCGTTCCGAACGAAAAAACCGGCGAGGCACTCAAAGTG
TTCGTCGTCAAAAAAGACCCGTCTTTGACCAAAGAAGAACTCACCGCTTT
CTGCCGTACCGGTCTGACCGCATACAAAGTGCCGAAAGACATCGAATTCC
GCGACGAGTTGCCCAAGTCCAATGTCGGCAAAATCCTGCGCCGCGAGTTG
CGCCAAAGTGCCGGGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy