Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0978 IGR0976 IGR0975 IGR0981 IGR0982 IGR0977 IGR0980 IGR0983 IGR0979 IGR0984 dagK, - NG1216 NG1215 tpn, - NG1211 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 NG1210 NG1208 NG1209 uvrA, - NG1207 dagK, - NG1216 NG1215 tpn, - NG1211 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 NG1210 NG1208 NG1209 uvrA, - NG1207 dagK, - NG1216 NG1215 tpn, - NG1211 trmU, - NG1214 pyrG, - NG1212 fadD,lfcA, - NG1213 NG1210 NG1208 NG1209 uvrA, - NG1207
* Calculated from Protein Sequence

Gene ID: NG1212

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pyrG  

Definition:
CTP synthase

Gene Start:
1162592

Gene Stop:
1160961

Gene Length:
1632

Molecular Weight*:
59832

pI*:
6.20

Net Charge*:
-8.14

EC:
6.3.4.2  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Meng Q, Switzer RL. Regulation of transcription of the Bacillus subtilis pyrG gene, encoding cytidine
triphosphate synthetase.
J Bacteriol. 2001 Oct;183(19):5513-22.
PMID: 11544212 Wadskov-Hansen SL, Willemoes

M, Martinussen J, Hammer K, Neuhard J, Larsen S.
Cloning and verification of the Lactococcus lactis pyrG
gene and characterization of the gene product, CTP synthase.
J Biol Chem. 2001 Oct 12;276(41):38002-9.
PMID: 11500486

Comment:
Oklahoma ID: NGO.1212c


For other 'pyr' genes, see NG0029 (pyrE), NG0255 (pyrC), NG0401 (pyrF), NG0589 (pyrP), NG1876 (pyrI), NG1761 (pyrD), NG1973 (pyrH).

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to CTP synthase sequences, e.g. residues 2-543 are 64% similar to the pyrG protein of Pasteurella multocida (gb|AAK03956).

Residues 1-544 are virtually identical to the enzyme in N.meningitidis (gb|AAF41908).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0504
COG name: CTP synthase (UTP-ammonia lyase)
Functional Class:  F
The phylogenetic pattern of COG0504 is amtkYqvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000991 (Glutamine amidotransferase class-I) with a combined E-value of 3.3e-10.
    IPB000991A    375-384
    IPB000991B    511-521


ProDom Summary:  Protein Domain Search
Residues 2-385 are 64% similar to a (CTP SYNTHASE LIGASE SYNTHETASE) protein domain (PD002309) which is seen in PYRG_ECOLI.

Residues 388-543 are 64% similar to a (CTP SYNTHASE SYNTHETASE LIGASE) protein domain (PD002477) which is seen in PYRG_HAEIN.



Paralogs:  Local Blast Search


NG1212 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 277 (E-value = 1.6e-214) place NG1212 in the CTP_synth_N family which is described as CTP synthase N-terminus (PF06418)
Residues 299 to 537 (E-value = 1.2e-60) place NG1212 in the GATase family which is described as Glutamine amidotransferase class-I (PF00117)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
32
transmembrane  
11  
27

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTKFIFVTGGVVSSLGKGIAAASIAAILESRGLNVTMLKLDPYINVDPGT
MSPFQHGEVFVTDDGAETDLDLGHYERFIDSTMTRRNSFSTGQVYENVIA
KERRGDYLGGTVQVIPHITDEIKRRIHEGAAGYDVAIVEIGGTVGDIESL
PFLEAIRQMRSQLGRNNTLFAHLSYVPYIAAAGEIKTKPTQHTVKEMLSI
GLQPDILICRMDRKMPADERRKIALFCNVEERAIVGSYDVDSIYECPEML
HDQGIDNIITEQLQLNVQQADLTAWKKIVHAVKNPKHTVKIAMVGKYVDL
TESYKSLIEALKHAGIHTETDVQITFVDSESIEKNKGDVSVLKDMDAILV
PGGFGSRGVEGKIAAVRYARENNVPYLGICLGMQIALIEYARDVAGLKGA
NSTEFDLKCAAPVVALIDEWQTADGSVETRDESADLGGTMRLGAQEVELK
AGSLAVKIYGSGHIRERHRHRYEVNNNYVSALEQAGLVIGGVSAGRERLV
ETIELPNHPWFFACQFHPEFTSNPRKGHPLFTAFVKAALNNKKA

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCAAATTCATTTTCGTAACCGGCGGCGTTGTCTCCTCACTGGGTAA
AGGTATCGCCGCCGCTTCTATTGCCGCCATCCTCGAATCGCGCGGCTTGA
ACGTTACCATGCTCAAGCTTGATCCTTATATCAACGTCGATCCCGGCACG
ATGAGCCCGTTCCAACACGGCGAAGTGTTCGTAACCGACGACGGCGCGGA
AACCGACCTCGACTTGGGACACTACGAACGTTTCATCGATTCCACGATGA
CCCGCCGCAACAGCTTCAGCACGGGTCAGGTGTACGAAAACGTTATCGCC
AAAGAACGCCGCGGCGACTATCTCGGCGGTACGGTTCAAGTCATCCCGCA
CATTACCGACGAAATCAAACGACGCATCCACGAAGGCGCGGCGGGTTACG
ATGTGGCGATTGTCGAAATCGGCGGTACGGTCGGCGACATCGAATCGCTG
CCGTTTTTGGAAGCCATCCGCCAGATGCGAAGCCAGTTGGGACGCAACAA
CACCCTGTTCGCCCACTTGAGCTACGTTCCCTACATCGCCGCCGCAGGCG
AAATCAAAACCAAGCCGACCCAGCACACCGTGAAAGAAATGTTGAGCATC
GGCTTGCAACCCGACATCCTGATTTGCCGTATGGACAGGAAAATGCCGGC
AGACGAACGCCGCAAAATCGCCTTGTTCTGCAACGTGGAAGAGCGCGCGA
TTGTCGGCAGCTACGATGTGGACAGCATCTACGAATGCCCCGAAATGCTG
CACGACCAAGGCATCGACAACATCATTACCGAGCAGTTGCAGCTTAACGT
GCAGCAGGCGGATTTGACCGCGTGGAAAAAAATCGTCCACGCCGTCAAAA
ACCCGAAACACACCGTCAAAATCGCGATGGTCGGCAAATACGTTGATTTG
ACCGAATCCTACAAATCATTGATTGAAGCCTTGAAACACGCGGGCATCCA
TACCGAAACCGATGTGCAGATTACCTTCGTTGACAGCGAAAGCATCGAGA
AAAACAAGGGCGACGTTTCCGTACTCAAAGATATGGATGCCATCCTCGTT
CCCGGCGGCTTCGGTTCGCGCGGCGTGGAAGGCAAAATCGCCGCCGTGCG
CTACGCCCGTGAAAACAACGTGCCATACTTGGGCATCTGCCTCGGTATGC
AGATTGCGCTGATTGAATACGCCCGCGACGTGGCAGGTTTGAAAGGTGCG
AATTCCACTGAGTTTGACTTGAAATGCGCTGCCCCCGTCGTCGCCCTGAT
TGACGAATGGCAAACCGCCGACGGCAGCGTCGAAACCCGTGACGAATCCG
CCGATTTGGGCGGCACGATGCGTTTGGGCGCGCAAGAAGTCGAATTGAAA
GCAGGCAGCCTCGCCGTCAAAATCTACGGCAGCGGACACATTCGCGAACG
CCACCGCCACCGCTACGAAGTCAACAACAACTATGTTTCCGCGCTGGAAC
AGGCAGGTTTGGTCATCGGCGGCGTATCCGCCGGACGCGAACGCTTGGTC
GAAACCATCGAACTGCCGAACCATCCTTGGTTCTTCGCCTGCCAGTTCCA
TCCCGAGTTCACGTCCAACCCGCGCAAAGGGCATCCTTTGTTCACCGCGT
TTGTCAAAGCCGCGTTGAACAATAAAAAAGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy