Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0978 IGR0976 IGR0975 IGR0977 IGR0980 IGR0979 IGR0974 tpn, - NG1211 psd, - NG1206 pyrG, - NG1212 fadD,lfcA, - NG1213 NG1210 NG1208 NG1209 uvrA, - NG1207 tpn, - NG1211 psd, - NG1206 pyrG, - NG1212 fadD,lfcA, - NG1213 NG1210 NG1208 NG1209 uvrA, - NG1207 tpn, - NG1211 psd, - NG1206 pyrG, - NG1212 fadD,lfcA, - NG1213 NG1210 NG1208 NG1209 uvrA, - NG1207
* Calculated from Protein Sequence

Gene ID: NG1209

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
DNA (cytosine-5-)-methyl transferase

Gene Start:
1158537

Gene Stop:
1159667

Gene Length:
1131

Molecular Weight*:
42970

pI*:
8.60

Net Charge*:
5.30

EC:
2.1.1.37  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Methionine metabolism

Primary Evidence:
Stein,D.C., Gunn,J.S., Radlinska,M. and Piekarowicz,A.
Restriction and modification systems of Neisseria gonorrhoeae
Gene 157 (1-2), 19-22 (1995)
M: 95331562

Zhu,P., Morelli,G. and Achtman,M.
The opcA and (psi)opcB regions in Neisseria: genes, pseudogenes,
deletions, insertion elements and DNA islands. Mol. Microbiol. 33 (3), 635-650 (1999)
M: 99348393

Stein,D.C., Chien,R. and Seifert,H.S.
Construction of a Neisseria gonorrhoeae MS11 derivative deficient
in NgoMI restriction and modification. J. Bacteriol. 174 (15), 4899-4906 (1992)
M:92332422


Comment:
Oklahoma ID: NGO.1209

Blast Summary:  PSI-Blast Search
NG1209 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 10444408,a predicted DNA cytosine methyltransferase. See also gb|AAA86270, pir||A42709

Numerous matches in gapped BLAST to methyltransferases, e.g. residues 1-372 are 60% similar to a DNA-methyltransferase in E.coli (gb|AAC37145.

Residues 6-355 are merely 23% similar to the predicted C-5 cytosine-specific DNA methylase from N.meningitidis (7226061).

COGS Summary:  COGS Search
BeTs to 7 clades of COG0270
COG name: Site-specific DNA methylase dcm
Functional Class:  L
The phylogenetic pattern of COG0270 is -Mtk---ceB-hUJ-------
Number of proteins in this genome belonging to this COG is 8

Blocks Summary:  Blocks Search
***** IPB001525 (C-5 cytosine-specific DNA methylase) with a combined E-value of 1.8e-54.
    IPB001525A    4-17
    IPB001525B    64-79
    IPB001525C    87-114
    IPB001525D    162-188
    IPB001525E    319-334
    IPB001525F    346-355


ProDom Summary:  Protein Domain Search
Residues 65-194 are 65% similar to a (METHYLTRANSFERASE TRANSFERASE METHYLASE MODIFICATION) protein domain (PD000445) which is seen in Q59380_ECOLI.

Residues 291-371 are 75% similar to a (METHYLTRANSFERASE TRANSFERASE METHYLASE MODIFICATION) protein domain (PD000554) which is seen in Q59380_ECOLI.

Residues 197-290 are 52% similar to a (MODIFICATION METHYLASE EC 2.1.1.73) protein domain (PD084613) which is seen in Q59380_ECOLI.

Residues 6-64 are 45% similar to a (METHYLTRANSFERASE TRANSFERASE METHYLASE MODIFICATION) protein domain (PD000515) which is seen in Q59380_ECOLI.



Paralogs:  Local Blast Search


NG1209 is paralogously related to NG0365 (site-specific DNA-methyltransferase (cytosine-specific) NgoVII) (2e-35), NG0873 (DNA modification methylase) (5e-34), NG1894 (5-methylcytosine methyltransferase) (4e-26), NG1795 (site-specific DNA-methyltransferase (cytosine-specific)) (2e-23), NG1991 (cytosine DNA methylase M.NgoI) (4e-23) and NG0676 (modification methylase M.NgoV (site-specific DNA-methyltransferase)) (6e-18).


Pfam Summary:  Pfam Search
Residues 1 to 367 (E-value = 3.4e-55) place NG1209 in the DNA_methylase family which is described as C-5 cytosine-specific DNA methylase (PF00145)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1DCT|1DCT-A DNA (CYTOSINE-5) METHYLASE FROM HAEIII 71.8 2e-13
pdb|10MH|10MH-A TERNARY STRUCTURE OF HHAI METHYLTRANSFERASE WITH 68.7 2e-12
pdb|1FJX|1FJX-A STRUCTURE OF TERNARY COMPLEX OF HHAI 68.7 2e-12
pdb|1DCT|1DCT-A DNA

Gene Protein Sequence:
MKSLEIFSGAGGLAKGLELAGFQHASFIELNKDACNSLRSNFNPKLVYQG
DVADFDLSSQEGIEVIAGGPPCQPFSLGGKHLAHEDRRDMFPHAVRYVEY
YRPKAFIFENVKGLLRKSFADYFEYILLRLTYPNLGILQNEDWKGHLTRL
KEIEFNLYKGIKYKVSYQLLNAADYGVPQKRERVVIVGIRADLDIDWKFP
KRTHSEDRLNWEKYVTGEYWEKHNEPKRFNKDIAEKLQKKYGIFEPEKKP
WQTVRDTLSDIPHPLGNHKITGHEYRDGARIYPGHTGSGIDEPSKTIKAG
GHGVPGGENMIRYDDGTVRYFTSYEAKLLQTFPEEFVISGAWGEAMRQIG
NAVPVKLSEILGKHLMGVLSEKSSLHN

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGTCTTTGGAAATTTTTTCCGGCGCGGGCGGGTTGGCAAAAGGCCT
TGAACTTGCAGGATTCCAACATGCATCTTTTATTGAACTCAATAAAGATG
CATGCAATTCTTTAAGAAGCAACTTTAACCCCAAGCTTGTTTATCAGGGA
GATGTGGCAGATTTTGATCTTTCCAGTCAAGAAGGCATAGAAGTCATTGC
AGGCGGTCCTCCTTGCCAGCCCTTTTCATTGGGCGGGAAACACCTTGCCC
ATGAAGACAGAAGGGATATGTTTCCTCATGCGGTCAGATATGTGGAGTAT
TACCGCCCCAAAGCTTTTATCTTTGAGAATGTAAAAGGACTTTTAAGAAA
ATCATTCGCTGATTATTTTGAATATATCCTACTTCGGCTTACTTATCCGA
ATCTTGGTATTTTGCAGAATGAAGATTGGAAAGGCCATCTGACACGGCTG
AAAGAAATTGAATTCAATTTATATAAAGGAATCAAATATAAGGTTTCATA
TCAATTGTTGAATGCAGCTGATTACGGAGTGCCGCAAAAACGCGAACGCG
TGGTTATCGTAGGTATCCGGGCCGATTTGGATATTGATTGGAAATTCCCA
AAAAGAACACATTCCGAAGACAGGTTGAATTGGGAAAAGTATGTAACGGG
GGAATACTGGGAAAAACACAACGAACCCAAAAGATTCAATAAAGATATTG
CTGAAAAGTTACAAAAAAAATACGGTATATTCGAACCAGAAAAAAAACCT
TGGCAAACGGTAAGGGATACCTTGTCCGACATCCCGCATCCTTTGGGGAA
TCATAAAATTACAGGACATGAATATAGGGATGGCGCAAGAATTTATCCCG
GACACACAGGAAGCGGGATAGACGAACCGTCCAAAACCATTAAAGCAGGT
GGGCATGGCGTTCCCGGCGGAGAAAATATGATTCGTTATGATGATGGAAC
AGTCAGATACTTTACCAGCTATGAAGCAAAACTTCTTCAAACATTCCCTG
AAGAATTTGTCATTTCTGGAGCTTGGGGAGAAGCAATGCGACAAATTGGC
AATGCGGTTCCTGTCAAATTGTCGGAAATTTTAGGCAAACATCTGATGGG
GGTGTTGTCGGAGAAAAGCAGCCTGCACAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy