Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0976 IGR0975 IGR0971 IGR0974 IGR0972 IGR0973 trpG, - NG1204 psd, - NG1206 trpD, - NG1203 NG1208 NG1209 tonB, - NG1205 uvrA, - NG1207 trpG, - NG1204 psd, - NG1206 trpD, - NG1203 NG1208 NG1209 tonB, - NG1205 uvrA, - NG1207 trpG, - NG1204 psd, - NG1206 trpD, - NG1203 NG1208 NG1209 tonB, - NG1205 uvrA, - NG1207
* Calculated from Protein Sequence

Gene ID: NG1206

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
psd  

Definition:
phosphatidylserine decarboxylase

Gene Start:
1154871

Gene Stop:
1154095

Gene Length:
777

Molecular Weight*:
28280

pI*:
8.20

Net Charge*:
2.29

EC:
4.1.1.65  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism
Glycine, serine and threonine metabolism

Secondary Evidence:
Li,Q.X. and Dowhan,W.
Studies on the mechanism of formation of the pyruvate prosthetic
group of phosphatidylserine decarboxylase from Escherichia coli
J. Biol. Chem. 265 (7), 4111-4115 (1990)
M:90154105

Dowhan,W. and Li,Q.X.
Phosphatidylserine decarboxylase from Escherichia coli
Meth. Enzymol. 209, 348-359 (1992)
M:92356881


Comment:
Oklahoma ID: NGO.1206c

Blast Summary:  PSI-Blast Search
NG1206 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1143229, a hypothetical.

Several hits in gapped BLAST to hypothetical proteins and to phosphatidylserine decarboxylase sequences. Residues 2-211 are 45% similar to a phosphatidylserine decarboxylase in Sinorhizobium
meliloti (gb|AAG00421).

Residues 1-259 are virtually identical to a predicted phosphotidylserine decarboxylase, NMB0963, in N.meningitidis (gb|AAF41369).

COGS Summary:  COGS Search
BeTs to 7 clades of COG0688
COG name: Phosphatidylserine decarboxylase
Functional Class:  I
The phylogenetic pattern of COG0688 is amt-Y---ebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003817 (Phosphatidylserine decarboxylase) with a combined E-value of 1.5e-12.
    IPB003817A    42-56
    IPB003817B    64-72
    IPB003817C    93-105
    IPB003817D    109-135
    IPB003817E    173-189


ProDom Summary:  Protein Domain Search
Residues 9-212 are identical to a (PROTEIN PHOSPHATIDYLSERINE DECARBOXYLASE) protein domain (PD016896) which is seen in Q50967_NEIGO.

Residues 213-259 are 65% similar to a (HYPOTHETICAL 28.3 KD PROTEIN) protein domain (PD106207) which is seen in Q50967_NEIGO.



Paralogs:  Local Blast Search


NG1206 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 42 to 211 (E-value = 9.8e-32) place NG1206 in the PS_Dcarbxylase family which is described as Phosphatidylserine decarboxylase (PF02666)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
17  
33
non-globular  
190  
259

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MNRLYPHPIIAREGWPIIGGGLALSLLVSMCCGWWSLPFWVFTVFALQFF
RDPAREIPQNPEAVLSPVDGRIVVVERARDPYRDVDALKISIFMNVFNVH
SQKSPADCTVTKVVYNKGKFVNADLDKASTENERNAVLATTASGREITFV
QVAGLVARRILCYTQAGAKLSRGERYGFIRFGSRVDMYLPVDAQAQVAIG
DKVTGVKTVLARLPLTDSQADPVSQAASVETAANPSAEQQQIEAAAAKIQ
AAVQDVLKD

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCGTCTTTATCCCCACCCGATTATCGCCCGTGAGGGCTGGCCGAT
TATCGGCGGCGGTTTGGCTTTGAGCCTGCTGGTGTCGATGTGCTGCGGCT
GGTGGTCTTTGCCGTTTTGGGTGTTTACCGTATTTGCATTGCAGTTTTTC
CGCGACCCTGCGCGTGAAATTCCGCAAAATCCTGAAGCGGTGTTGAGTCC
GGTTGACGGCCGTATCGTGGTGGTCGAGCGCGCACGCGATCCGTATCGTG
ATGTCGATGCTTTGAAAATCAGTATTTTTATGAACGTGTTCAACGTGCAT
TCGCAAAAATCGCCTGCCGATTGTACGGTAACGAAAGTGGTCTATAACAA
AGGCAAATTCGTGAATGCGGATTTGGACAAAGCCAGCACGGAAAACGAAC
GCAACGCGGTTTTGGCGACTACGGCTTCCGGTCGTGAAATTACTTTTGTT
CAAGTGGCCGGTCTGGTGGCACGCCGTATTTTGTGTTACACCCAAGCAGG
TGCGAAACTGTCCCGCGGCGAACGCTATGGCTTTATCCGCTTCGGTTCGC
GCGTGGATATGTATCTGCCTGTCGATGCGCAGGCGCAAGTGGCGATTGGT
GATAAAGTAACCGGCGTAAAAACCGTATTGGCGCGTTTGCCGCTGACTGA
TTCTCAAGCCGATCCTGTTTCACAAGCTGCTTCGGTTGAAACAGCGGCAA
ACCCATCTGCCGAACAGCAGCAAATCGAAGCGGCGGCGGCTAAGATTCAG
GCGGCTGTGCAAGATGTGTTGAAAGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy