Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0970 IGR0971 IGR0968 IGR0970.1 IGR0969 IGR0972 IGR0973 NG1201 trpG, - NG1204 psd, - NG1206 pivNG, - NG1200 trpD, - NG1203 NG1202 tonB, - NG1205 hrpA, - NG1199 NG1201 trpG, - NG1204 psd, - NG1206 pivNG, - NG1200 trpD, - NG1203 NG1202 tonB, - NG1205 hrpA, - NG1199 Type: inverse, Name:  - 167 Type: inverse, Name:  - 143 Type: inverse, Name:  - 144 Type: inverse, Name:  - 162 Type: inverse, Name:  - 182 NG1201 trpG, - NG1204 psd, - NG1206 pivNG, - NG1200 trpD, - NG1203 NG1202 tonB, - NG1205 hrpA, - NG1199
* Calculated from Protein Sequence

Gene ID: NG1203

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trpD  

Definition:
anthranilate phosphoribosyltransferase

Gene Start:
1150377

Gene Stop:
1149334

Gene Length:
1044

Molecular Weight*:
36974

pI*:
6.00

Net Charge*:
-3.68

EC:
2.4.2.18  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Essar,D.W., Eberly,L. and Crawford,I.P.
Evolutionary differences in chromosomal locations of four early
genes of the tryptophan pathway in fluorescent pseudomonads: DNA
sequences and characterization of Pseudomonas putida trpE and
trpGDC.
J. Bacteriol. 172 (2), 867-883 (1990)
Medline: 90130325


Comment:
Oklahoma ID: NGO.1203c

For other trp genes, see NG0248 (trpA), NG0274 (trpB), NG0872 (trpE), NG0261 (trpF), NG1204 (trpG), NG1721 (trpC)

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to anthranilate phosphoribosyltransferases and synthases. Residues 8-346 are 46% similar to the enzyme in X.fastidiosa (gb|AAF83025).

Residues 7-346 are 88% similar to NMA1164 in N.meningitidis (gb|AAF41372).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0547
COG name: Anthranilate phosphoribosyltransferase
Functional Class:  E
The phylogenetic pattern of COG0547 is amt-yqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000312 (Glycosyl transferase family) with a combined E-value of 5.7e-56.
    IPB000312A    92-138
    IPB000312B    161-203


ProDom Summary:  Protein Domain Search
Residues 14-324 are 46% similar to a (TRANSFERASE ANTHRANILATE) protein domain (PD001864) which is seen in TRPD_PSEPU.



Paralogs:  Local Blast Search


NG1203 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 74 (E-value = 2.1e-17) place NG1203 in the Glycos_trans_3N family which is described as Glycosyl transferase family, helical bundle domain (PF02885)
Residues 81 to 334 (E-value = 2.4e-124) place NG1203 in the Glycos_transf_3 family which is described as Glycosyl transferase family, a/b domain (PF00591)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
33  
143
non-globular  
265  
348

PDB Hit:
pdb|1O17|1O17-A ANTHRANILATE PHOSPHORIBOSYL-TRANSFERASE (TRPD) 181.0 2e-46
pdb|1KGZ|1KGZ-A CRYSTAL STRUCTURE ANALYSIS OF THE ANTHRANILATE 172.0 9e-44
pdb|1O17|1O17-A ANTHRANILATE PHOSPHORIBOSYL-TRANSFERASE (TRPD) 416.0 0e+00

Gene Protein Sequence:
LNGGQKMITPQQAIERLISNNELFYDEMTDLMRQMMSGKVPPEQIAAILT
GLRIKVETVSEITAAAAVMCEFASKVPLEDADGLVDIVGTGGDGAKTFNI
STTSMFVAAAAGAKVAKHGGRSVSSSSGAADVMEQMGANLNLTPEQIAQS
IRQTGIGFMFAPNHHSAMRHVAPVRRSLGFRSIFNILGPLTNPAGAPNQL
LGVFHTDLCGILSRVLQQLGSKHVLVVCGEGGLDEITLTGKTRVAELKDG
KISEYDIRPEDFGIETRRNLDEIKVANTQESLLKMNEVLDGKEGAARDIV
LLNTAAALYAGNIAASLSDGISAAREGIDSGRAKAKKEEFVGFTRQFA

Gene Nucleotide Sequence:  Sequence Viewer
TTGAACGGAGGACAAAAAATGATTACACCGCAACAGGCTATCGAACGATT
AATCAGCAATAACGAGTTGTTTTACGATGAAATGACCGACTTGATGCGCC
AAATGATGAGCGGAAAAGTGCCGCCCGAACAAATTGCGGCGATTTTGACC
GGCTTGCGTATCAAGGTTGAAACCGTTTCCGAAATCACCGCCGCCGCCGC
CGTGATGTGCGAGTTTGCGTCAAAAGTGCCGCTGGAGGATGCGGACGGGC
TGGTCGATATCGTCGGTACGGGCGGGGATGGCGCGAAAACCTTCAATATT
TCGACGACTTCGATGTTTGTTGCTGCAGCGGCAGGCGCAAAGGTTGCCAA
ACACGGAGGCCGGTCGGTCTCTTCCTCCAGCGGTGCGGCTGACGTGATGG
AGCAAATGGGCGCAAACCTCAACCTGACTCCCGAACAGATTGCCCAAAGT
ATCAGGCAGACCGGTATAGGGTTTATGTTCGCACCCAATCACCACAGTGC
CATGCGCCATGTCGCCCCGGTGCGCCGTTCGCTCGGTTTCCGAAGCATTT
TCAACATATTGGGTCCGTTAACCAATCCTGCGGGCGCGCCGAACCAGCTT
TTGGGCGTGTTCCACACCGATTTGTGCGGCATTTTGTCGCGGGTCTTGCA
ACAACTCGGCTCAAAACACGTTTTGGTCGTTTGCGGGGAGGGCGGTTTGG
ATGAAATTACACTGACGGGCAAAACGCGCGTTGCCGAACTCAAAGACGGA
AAAATCAGCGAATACGACATCCGCCCAGAAGATTTCGGTATCGAAACCCG
CCGCAATTTGGATGAAATCAAAGTTGCCAATACTCAGGAATCTTTGTTGA
AAATGAACGAGGTACTGGACGGGAAAGAAGGGGCGGCGCGCGATATCGTA
TTGCTTAATACCGCCGCCGCCTTATATGCCGGAAATATCGCTGCTTCGCT
TTCAGACGGCATATCTGCCGCACGGGAAGGCATCGATTCAGGTAGGGCGA
AGGCGAAAAAAGAGGAGTTTGTCGGTTTTACACGGCAATTCGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy