Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0962 IGR0960 IGR0964 IGR0963 IGR0965 IGR0958 IGR0961 IGR0959 hsp33, - NG1189 NG1191 NG1192 NG1190 NG1193 argJ, - NG1194 NG1195 mgtE, - NG1188 NG1197 hsp33, - NG1189 NG1191 NG1192 NG1190 NG1193 argJ, - NG1194 NG1195 mgtE, - NG1188 NG1197 Type: tandem, Name:  - 57 hsp33, - NG1189 NG1190 NG1193 argJ, - NG1194 NG1195 mgtE, - NG1188 NG1197 hrpA, - NG1196 hrpA, - NG1196 NG1192 NG1191
* Calculated from Protein Sequence

Gene ID: NG1194

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
argJ  

Definition:
ornithine acetyltransferase (ArgJ) (arginine biosynthesis bifunctional protein)

Gene Start:
1135981

Gene Stop:
1137198

Gene Length:
1218

Molecular Weight*:
42839

pI*:
5.20

Net Charge*:
-9.34

EC:
2.3.1.1  2.3.1.35  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Urea cycle and metabolism of amino groups

Primary Evidence:
Martin,P.R. and Mulks,M.H.,
Sequence analysis and complementation studies of the argJ gene
encoding ornithine acetyltransferase from Neisseria gonorrhoeae,
J. Bacteriol. 174 (8), 2694-2701 (1992)

Martin,P.R. and Mulks,M.H.
Molecular characterization of the argJ mutation in Neisseria
gonorrhoeae strains with requirements for arginine, hypoxanthine,
and uracil
Infect. Immun. 60 (3), 970-975 (1992)
M:92176016


Secondary Evidence:
Chou CF, Chen CW.
argJ mutations are highly inducible by ethidium bromide in proB strains of Streptomyces lividans: implication of pathway
interactions.
Biochem Biophys Res Commun. 1992 Dec 15;189(2):1101-9.
PMID: 1472020

Comment:
See also: ArgA, NG0027; ArgB, NG0844; ArgC, NG0118; ArgD, NG0646; ArgF, NG1232; ArgG, NG1961; ArgH, NG0219.

This enzyme catalyzes the first and fifth steps in arginine biosynthesis.

Oklahoma ID: NGO.1194

Blast Summary:  PSI-Blast Search
NG1194 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 150243.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1364
COG name: Ornithine acetyltransferase/N-acetylglutamate synthase
Functional Class:  E
The phylogenetic pattern of COG1364 is amt--qvc-br----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002813 (ArgJ family) with a combined E-value of 2.5e-150.
    IPB002813A    48-60
    IPB002813B    74-89
    IPB002813C    118-138
    IPB002813D    147-158
    IPB002813E    176-214
    IPB002813F    220-239
    IPB002813G    265-309
    IPB002813H    310-330
    IPB002813I    379-406


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1194 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 19 to 406 (E-value = 1.2e-237) place NG1194 in the ArgJ family which is described as ArgJ family (PF01960)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
36  
52

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MAVNLTEKTAEQLPDIDGIALYTAQAGVKKPGHTDLTLIAVAAGSTVGAV
FTTNRFCAAPVHIAKSHLFDEDGVRALVINTGNANAGTGAQGRIDALAVC
AAAARQIGCKPNQVMPFSTGVILEPLPADKIIAALPKMQPAFWNEAARAI
MTTDTVPKAASREGKVGDQHTVRATGIAKGSGMIHPNMATMLGFIATDAK
VSQPVLQLMTQEIADETFNTITVDGDTSTNDSFVIIATGKNSQSEIDNIA
DPRYAQLKELLCSLALELAQAIVRDGEGATKFITVRVENAKTCDEARQAA
YAAARSPLVKTAFFASDPNLGRLLAAIGYADVADLDTDLVEMYLDDILVA
EHGGRAASYTEAQGQAVMSKDEITVRIKLHRGQAAATVYTCDLSHGYVSI
NADYRS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGTCAACCTGACCGAAAAAACCGCCGAACAACTGCCCGACATCGA
CGGCATTGCCCTCTACACCGCCCAAGCAGGCGTGAAGAAGCCCGGGCATA
CCGACCTGACACTGATTGCCGTAGCCGCCGGCAGCACCGTCGGTGCAGTC
TTCACGACCAACCGTTTCTGTGCCGCGCCCGTCCACATCGCCAAATCGCA
CCTTTTCGACGAAGACGGCGTGCGCGCCCTCGTCATCAACACGGGCAACG
CCAACGCGGGTACGGGCGCACAGGGCAGAATCGATGCTTTGGCAGTGTGT
GCCGCCGCCGCCCGGCAAATCGGCTGCAAACCGAACCAGGTGATGCCCTT
CTCCACCGGCGTGATTCTCGAACCGCTGCCCGCAGACAAAATCATCGCCG
CCCTGCCCAAAATGCAGCCTGCCTTCTGGAACGAAGCGGCACGCGCCATC
ATGACCACCGACACCGTTCCCAAAGCCGCCTCGCGCGAAGGCAAGGTCGG
CGACCAACACACCGTCCGCGCCACAGGCATTGCCAAAGGCTCGGGCATGA
TTCATCCCAATATGGCGACCATGCTCGGTTTCATCGCCACCGATGCCAAA
GTTTCCCAACCCGTCCTCCAACTGATGACGCAGGAAATCGCCGACGAAAC
CTTCAACACCATCACCGTTGACGGCGACACCAGCACCAACGACAGCTTCG
TCATCATCGCCACCGGCAAAAACAGCCAAAGCGAAATCGACAACATCGCC
GACCCGCGTTACGCCCAACTCAAAGAATTGTTGTGCAGCCTTGCGCTCGA
ACTCGCCCAAGCCATCGTCCGCGACGGCGAGGGCGCGACCAAGTTCATCA
CCGTCCGCGTCGAAAACGCCAAAACCTGCGACGAAGCCCGCCAAGCCGCC
TACGCCGCGGCACGTTCGCCACTGGTCAAAACCGCCTTTTTCGCCTCCGA
CCCCAACCTCGGCAGGCTGCTCGCCGCCATCGGTTATGCCGACGTTGCCG
ACCTCGATACCGACCTCGTGGAAATGTATCTCGACGATATTTTGGTTGCC
GAACACGGCGGACGCGCCGCAAGCTACACCGAAGCACAAGGGCAGGCGGT
GATGTCGAAGGACGAAATCACCGTCCGCATCAAGCTGCATCGCGGACAAG
CCGCCGCCACCGTCTATACCTGCGACCTGTCGCACGGATACGTTTCCATC
AACGCCGACTACCGTTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy