Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0962 IGR0956 IGR0960 IGR0955 IGR0958 IGR0953 IGR0954 IGR0961 IGR0957 IGR0959 NG1186 asrR, - NG1185 hsp33, - NG1189 NG1184 NG1191 NG1192 NG1190 NG1193 gloB, - NG1187 mgtE, - NG1188 purL, - NG1183 NG1186 asrR, - NG1185 hsp33, - NG1189 NG1184 NG1191 NG1192 NG1190 NG1193 gloB, - NG1187 mgtE, - NG1188 purL, - NG1183 Type: tandem, Name:  - 57 asrR, - NG1185 hsp33, - NG1189 NG1184 NG1186 NG1190 NG1193 gloB, - NG1187 mgtE, - NG1188 purL, - NG1183 NG1192 NG1191
* Calculated from Protein Sequence

Gene ID: NG1187

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gloB  

Definition:
hydroxyacylglutathione hydrolase (glyoxylase II) (GloB)

Gene Start:
1130149

Gene Stop:
1130898

Gene Length:
750

Molecular Weight*:
27796

pI*:
6.40

Net Charge*:
-4.01

EC:
3.1.2.6  

Functional Class:
Cellular processes; Detoxification  
Central intermediary metabolism; Pyruvate metabolism  

Pathway: pathway table
Pyruvate metabolism

Primary Evidence:
Kizil G, Wilks K, Wells D, Ala'Aldeen DA.
Detection and characterisation of the genes encoding glyoxalase I and II from Neisseria meningitidis.
J Med Microbiol. 2000 Jul;49(7):669-73.
PMID: 10882093

Comment:
For gloA gene see NG1661.

Oklahoma ID: NGO.1187

Blast Summary:  PSI-Blast Search
Residues 1-250 in NG1187 have 92% similarity to residues 1-250 in AE002549, N. meningitidis MC58 hydroxyacylglutathione hydrolase.
Residues 1-249 in NG1187 have 42% similarity to residues 2-252 in AE004295, V. cholerae putative hydroxyacylglutathione hydrolase GloB.


COGS Summary:  COGS Search
BeTs to 9 clades of COG0491
COG name: Zn-dependent hydrolases, including glyoxylases
Functional Class:  R
The phylogenetic pattern of COG0491 is AMtKYQVCEBRHuj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 99-169 are 52% similar to a (PROTEIN HYDROLASE GLYOXALASE II HYDROXYACYLGLUTATHIONE) protein domain (PD001940) which is seen in GLO2_HAEIN.



Paralogs:  Local Blast Search


NG1187 is paralogously related to NG2033 (glyoxylase II family protein) (2e-05).


Pfam Summary:  Pfam Search
Residues 11 to 166 (E-value = 1e-24) place NG1187 in the Lactamase_B family which is described as Metallo-beta-lactamase superfamily (PF00753)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1QH3|1QH3-A HUMAN GLYOXALASE II WITH CACODYLATE AND ACETATE 141.0 1e-34

Gene Protein Sequence:
MKITPVKALTDNYIWMIQHGNHAVCVDPSEPSPVLEFLVRNRLMLAQTWV
THPHPDHEGGAAALWRGYMESPVYGESDIEAATHTVTAGTRFTFGNGQVT
VWATPGHTDRHTSYLLETSDGIHVFCGDTLFSAGCGRVFTGTVEQLYDNF
QRFNQLPEGTLFYPAHEYTAANLRFAAHIEPDNADIQTALKAAEHTPTLP
VTLAHERRVNPFLRTEIPAVRQRAEALVGKTLNSGLEVFAALRELKNAYR


Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTACCCCCGTCAAAGCCCTGACCGACAACTACATCTGGATGAT
ACAGCACGGCAACCATGCCGTCTGCGTCGATCCTTCCGAACCCTCGCCCG
TCTTGGAATTCCTCGTACGCAACCGACTCATGCTCGCCCAAACCTGGGTA
ACGCACCCCCATCCCGACCACGAAGGCGGTGCGGCGGCACTCTGGCGCGG
CTACATGGAATCGCCCGTTTACGGCGAATCCGACATCGAAGCCGCCACCC
ACACCGTAACCGCCGGCACACGATTCACCTTCGGCAACGGTCAGGTTACC
GTTTGGGCAACACCCGGCCACACAGACCGCCACACCAGCTACCTTCTCGA
AACTTCAGACGGCATACACGTTTTCTGCGGCGACACCCTTTTTTCCGCCG
GCTGCGGACGCGTGTTTACCGGCACGGTCGAACAGCTTTACGACAACTTC
CAACGGTTCAACCAATTACCCGAAGGCACCCTGTTCTATCCGGCACACGA
ATACACCGCCGCCAACCTGCGTTTCGCCGCCCATATCGAGCCGGACAACG
CCGACATTCAGACGGCATTGAAGGCGGCGGAACACACGCCCACCCTGCCC
GTTACCCTCGCGCACGAACGCCGCGTCAACCCGTTCTTACGGACAGAAAT
CCCCGCCGTCCGCCAACGTGCCGAAGCCCTGGTCGGCAAAACGCTGAACA
GCGGTTTGGAAGTATTCGCCGCCCTGCGCGAACTGAAAAACGCCTACCGC



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy