Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap rRNA-16S-1 IGR0956 IGR0955 IGR0951.2 IGR0953 IGR0954 IGR0952 IGR0951 IGR0957 IGR0951.1 IGR0950 NG1186 asrR, - NG1185 glnB, - NG1182 NG1180 NG1181 NG1184 NG1179 gloB, - NG1187 mgtE, - NG1188 purL, - NG1183 NG1186 asrR, - NG1185 glnB, - NG1182 NG1180 NG1181 NG1184 NG1179 gloB, - NG1187 mgtE, - NG1188 purL, - NG1183 Type: direct, Name:  - 109 asrR, - NG1185 glnB, - NG1182 NG1180 NG1181 NG1184 NG1186 NG1179 gloB, - NG1187 mgtE, - NG1188 purL, - NG1183
* Calculated from Protein Sequence

Gene ID: NG1183

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
purL  

Definition:
phophoribosylformylglycinamidine synthase (PurL)

Gene Start:
1124294

Gene Stop:
1128247

Gene Length:
3954

Molecular Weight*:
143374

pI*:
5.00

Net Charge*:
-43.37

EC:
6.3.5.3  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Comment:
Oklahoma ID: NGO.1183

For other 'pur' genes, see NG0333 (purC), NG0398 (purA), NG0526 (purM), NG0748 (purE), NG0875 (purK), NG0263 (purF), NG1224 (purN), NG1466 (purH), NG1711 (purB), NG1939 (purD)

Blast Summary:  PSI-Blast Search
Residues 7-1318 in NG1183 have 56% similarity to residues 5-1295 in U36841, E. coli phosphoribosylformylglycineamide synthetase.
Residues 4-1314 in NG1183 have 55% similarity to residues 26-1317 in U32759, H. influenzae Rd phosphoribosylformylglycinamidine synthase.
NG1183 has similarity with P-value = 0.0 to phosphoribosylformylglycinamidine synthase proteins in several other organisms, e.g. residues 1-1318 are 91% similar to the enzyme in N.meningitidis (7227259).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0046
COG name: Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain
Functional Class:  F
The phylogenetic pattern of COG0046 is amtkyqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 224-414 are 56% similar to a (PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE FGAM) protein domain (PD009676) which is seen in PURL_ECOLI.

Residues 1172-1286 are 53% similar to a (SYNTHASE) protein domain (PD004290) which is seen in PURL_ECOLI.

Residues 607-824 are 57% similar to a (TEGUMENT PROTEIN MEMBRANE ANTIGEN P140 PROBABLE) protein domain (PD002906) which is seen in P74881_SALTY.

Residues 185-223 are 76% similar to a (PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II LIGASE) protein domain (PD004591) which is seen in PURL_HAEIN.

Residues 7-184 are 44% similar to a (PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE FGAM) protein domain (PD009626) which is seen in PURL_ECOLI.

Residues 826-1010 are 41% similar to a (PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II LIGASE FGAM) protein domain (PD001440) which is seen in PURL_ECOLI.

Residues 476-586 are 39% similar to a (PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE FGAM) protein domain (PD037529) which is seen in PUR4_DROME.

Residues 1012-1171 are 68% similar to a (PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE FGAM) protein domain (PD009675) which is seen in PURL_HAEIN.



Paralogs:  Local Blast Search


NG1183 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 241 to 421 (E-value = 4.9e-34) place NG1183 in the AIRS family which is described as AIR synthase related protein, N-terminal domain (PF00586)
Residues 431 to 591 (E-value = 2.8e-39) place NG1183 in the AIRS_C family which is described as AIR synthase related protein, C-terminal domain (PF02769)
Residues 821 to 994 (E-value = 8.3e-11) place NG1183 in the AIRS_C family which is described as AIR synthase related protein, C-terminal domain (PF02769)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
85
non-globular  
408  
459
non-globular  
573  
651

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSVVLPLRGVTALSDFRVEKLLQKAAALGLPEVKLSSEFWYFAGSEKALD
AATVEKLQALLAAQSVEQTPEAREGLHLFLVTPRLGTISPWASKATNIAE
NCGLAGIERIERGMAVWLEGALTDEQKQQWAALLHDRMTESVLPDFQTAS
KLFHHLKSETFSTVDVLGGGKEALVKANTETGLALSADEIDYLVENYQAL
QRNPSDVELMMFAQANSEHCRHKIFNADFILNGEKQPKSLFGMIRDTHNA
HPEGTVVAYKDNSSVIKGAKIERFYPNAAENQGYRFHEEDTHIIMKVETH
NHPTAIAPFAGAATGAGGEIRDEGATGKGSRPKAGLTGFTVSNLNIPDLK
QPWEQDYGKPEHISSPLDIMIEGPIGGAAFNNEFGRPNLLGYFRTFEEKF
DGQVRGYHKPIMIAGGLGSIQAQQTHKDEIPEGALLIQLGGPGMLIGLGG
GAASSMDTGTNDASLDFNSVQRGNPEIERRAQEVIDRCWQLGDQNPIISI
HDVGAGGLSNAFPELVNDAGRGAVFELREVPLEEHGLTPLQIWCNESQER
YVLSILEKDLDTFRAICERERCPFAVVGTATDDGHLKVRDDLFSNNPVDL
PLNVLLGKPPKTTRTDKTVTPSKKPFHAGDIDITEAAYRVLRLPAVAAKN
FLITIGDRSVGGMTHRDQMVGKYQTPVADCAVTMMGFNTYRGEAMSMGEK
PAVALFDAPASGRMCVGEAITNIAAVNIGDIGNIKLSANWMAACGNEGED
EKLYRTVEAVSKACQALDLSIPVGKDSLSMKTVWQDGEEKKSVVSPLSLI
ISAFAPVKDVRKTVTPELKNVEGSVLLFIDLGFGKARMGGSAFGQVYNNM
SGDAPDLDDAGRLKAFYSVIQQLVAEDKLLAYHDRSDGGLFATLAEMAFA
ARCGISADIDCLMDKFLPIHLPDFQGDPAEDLSDELYNHAAIKILFNEEL
GAVIQIRQKDRDYVDAAFETAGLTDAVSRIGSPDFDNEFISFFGYGYFLE
QNRADLQRAWQETSHAIQRLRDNPACADSEFALIGDNERSALFADVKFDV
NEDIAAPFINSGAKPKIAILREQGVNGQIEMAAAFTRAGFDAYDVHMSDL
MAGRFRLADFKMLAACGGFSYGDVLGAGEGWAKSILFHPALRDQFAAFFA
DPNTLTLGVCNGCQMVSNLAEIIPGAETWPKFKRNLSEQFEARLNMVHVP
KSASLILNEMQDSSLPVVVSHGEGRADFALHGGNISADLGIALQYVDGQN
QVTQTYPLNPNGSPQGIAGITNADGRVTIMMPHPERVYRAAQMSRKPEGW
TELSGWYRLFAGARKALG

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGTTGTTTTGCCCTTGCGCGGCGTTACCGCCCTTTCCGATTTCCG
TGTCGAAAAACTCTTGCAAAAAGCCGCCGCACTCGGCCTGCCCGAAGTCA
AATTAAGCAGCGAATTTTGGTATTTCGCCGGCAGCGAGAAAGCACTTGAT
GCCGCGACTGTCGAAAAACTGCAAGCCTTGTTGGCGGCGCAAAGCGTTGA
ACAAACGCCCGAAGCGCGCGAGGGTTTGCATTTGTTTTTGGTAACGCCCC
GTTTGGGTACGATTTCGCCGTGGGCTTCCAAGGCGACCAATATCGCGGAA
AACTGCGGTTTGGCAGGCATCGAACGCATCGAGCGCGGTATGGCGGTGTG
GCTGGAAGGTGCGCTTACCGATGAACAGAAACAGCAATGGGCGGCGTTGC
TGCACGACCGCATGACCGAATCCGTGCTGCCCGATTTTCAGACGGCATCC
AAATTATTCCACCATCTCAAATCCGAAACCTTCTCCACCGTCGATGTTTT
GGGCGGCGGTAAAGAGGCTTTGGTCAAAGCCAATACCGAAACGGGTTTGG
CACTCTCCGCCGACGAAATCGATTATCTGGTTGAAAACTATCAGGCTTTG
CAGCGCAATCCGTCCGATGTGGAGCTGATGATGTTCGCGCAGGCAAACAG
CGAACACTGCCGCCACAAAATCTTCAACGCCGATTTCATCCTCAACGGCG
AAAAACAACCGAAATCCCTGTTCGGCATGATACGCGACACGCACAACGCG
CATCCCGAAGGTACGGTCGTCGCCTATAAAGACAATTCGTCCGTGATCAA
AGGCGCGAAAATCGAGCGTTTCTATCCGAATGCAGCGGAAAACCAAGGCT
ACCGTTTCCACGAGGAAGACACCCACATCATCATGAAAGTGGAAACGCAC
AACCACCCGACCGCCATCGCGCCGTTTGCGGGCGCGGCAACAGGCGCGGG
CGGCGAAATCCGCGACGAAGGTGCGACGGGCAAAGGTTCGCGTCCGAAAG
CGGGCTTGACCGGCTTTACCGTGTCCAACCTCAACATCCCCGACCTCAAA
CAGCCGTGGGAACAAGACTACGGCAAGCCGGAACACATTTCCTCGCCGTT
GGACATCATGATTGAAGGCCCGATTGGCGGTGCGGCGTTCAACAACGAAT
TCGGCCGCCCGAACCTCTTGGGCTACTTCCGCACCTTTGAAGAAAAATTT
GACGGTCAGGTTCGCGGCTACCACAAACCGATTATGATTGCCGGCGGTTT
GGGCAGCATTCAGGCGCAGCAGACGCACAAAGACGAAATCCCCGAAGGCG
CACTGCTGATCCAACTGGGCGGCCCGGGCATGCTCATCGGCTTGGGCGGC
GGTGCGGCTTCTTCGATGGATACCGGTACAAATGATGCGTCTTTGGACTT
CAACTCCGTACAACGCGGCAACCCTGAAATCGAACGCCGCGCGCAGGAAG
TCATCGACCGCTGCTGGCAGCTCGGCGACCAAAACCCGATTATCTCCATC
CACGACGTGGGCGCGGGCGGCTTGTCCAACGCTTTCCCTGAATTGGTCAA
CGATGCCGGACGCGGCGCGGTATTCGAGCTGCGCGAAGTGCCGTTGGAAG
AACACGGTTTAACGCCTTTGCAAATCTGGTGTAACGAATCGCAAGAGCGT
TATGTCTTGTCGATTTTGGAAAAAGATTTGGACACCTTCCGCGCCATCTG
CGAACGCGAACGCTGCCCGTTTGCCGTAGTCGGCACGGCGACCGACGACG
GTCATTTGAAAGTGCGCGACGATTTGTTCTCCAACAACCCCGTCGATTTG
CCGCTGAACGTCTTGCTCGGCAAACCGCCCAAAACCACGCGTACCGACAA
AACGGTTACGCCGTCCAAAAAACCGTTTCACGCGGGCGATATCGACATCA
CCGAAGCCGCCTACCGCGTTTTGCGCCTGCCTGCCGTAGCCGCCAAAAAC
TTCCTGATTACCATCGGCGACCGCAGCGTCGGCGGCATGACCCACCGCGA
CCAAATGGTCGGCAAATACCAAACCCCCGTAGCCGACTGCGCCGTTACCA
TGATGGGCTTCAACACCTATCGCGGCGAAGCGATGTCTATGGGCGAAAAA
CCGGCCGTCGCCCTGTTTGACGCGCCCGCCTCGGGCAGAATGTGCGTCGG
CGAAGCCATCACCAACATCGCGGCAGTCAACATCGGCGACATCGGCAACA
TCAAACTTTCCGCCAACTGGATGGCGGCGTGCGGCAACGAAGGCGAAGAC
GAAAAACTCTACCGCACCGTCGAAGCCGTTTCTAAAGCCTGCCAGGCATT
GGATTTGAGCATTCCCGTAGGTAAAGACAGCCTGTCGATGAAAACCGTGT
GGCAGGACGGCGAAGAGAAAAAATCCGTGGTTTCGCCGTTGAGCCTGATT
ATTTCCGCGTTCGCGCCTGTTAAAGACGTGCGAAAAACCGTTACGCCCGA
ATTGAAAAACGTCGAAGGCAGCGTATTGCTGTTTATCGATTTGGGCTTCG
GCAAAGCGCGCATGGGCGGCTCGGCGTTCGGTCAGGTGTACAACAACATG
AGCGGCGACGCGCCCGATTTGGACGATGCAGGCCGTCTGAAAGCGTTTTA
CAGCGTAATTCAACAGCTTGTCGCCGAAGACAAACTTTTGGCGTATCACG
ACCGCAGCGACGGCGGTTTGTTTGCGACGCTGGCGGAAATGGCGTTTGCG
GCACGGTGCGGTATTAGTGCCGATATAGATTGCCTGATGGATAAATTCCT
GCCGATTCATCTCCCGGATTTTCAAGGCGACCCTGCCGAAGACTTATCTG
ACGAACTTTATAATCATGCCGCCATTAAAATCTTATTCAATGAAGAATTA
GGCGCGGTTATCCAAATCCGCCAAAAAGATAGGGATTATGTTGATGCGGC
ATTTGAAACGGCCGGCTTAACCGATGCGGTCAGCCGGATTGGCTCTCCTG
ATTTTGACAATGAGTTTATTTCTTTCTTTGGTTACGGTTATTTCTTGGAA
CAAAACCGCGCCGACCTGCAACGCGCGTGGCAGGAAACCAGCCACGCCAT
CCAACGCCTGCGCGACAACCCTGCCTGCGCCGACAGCGAGTTCGCCCTGA
TTGGCGACAACGAACGCAGCGCATTGTTTGCCGACGTGAAGTTCGACGTG
AACGAAGACATCGCCGCGCCGTTTATCAACAGTGGCGCGAAACCTAAAAT
CGCCATCCTGCGCGAACAGGGCGTAAACGGGCAAATCGAAATGGCCGCCG
CCTTCACCCGCGCCGGATTCGATGCCTACGACGTGCATATGTCCGACCTG
ATGGCTGGCCGCTTCCGCCTTGCCGACTTCAAAATGCTGGCGGCGTGCGG
CGGCTTCAGCTACGGCGACGTACTCGGCGCGGGTGAAGGCTGGGCGAAAT
CCATCCTGTTCCACCCTGCCTTGCGCGACCAATTCGCCGCCTTCTTTGCC
GATCCGAACACGCTGACATTGGGCGTGTGCAACGGCTGCCAAATGGTCAG
CAACCTTGCCGAAATTATCCCGGGCGCAGAAACATGGCCGAAGTTCAAAC
GCAACCTGAGCGAGCAGTTTGAAGCGCGCCTGAATATGGTTCACGTCCCC
AAATCAGCGTCGCTGATTTTGAACGAAATGCAAGACTCCAGCCTGCCTGT
CGTGGTCAGCCACGGCGAAGGCCGCGCCGACTTCGCGCTTCACGGCGGCA
ATATTTCCGCCGATTTGGGCATCGCGCTGCAATATGTGGACGGTCAAAAC
CAGGTTACCCAAACCTATCCGCTCAACCCCAACGGCTCGCCGCAGGGCAT
CGCCGGCATTACCAACGCCGACGGCCGCGTTACCATTATGATGCCCCACC
CCGAACGCGTGTACCGTGCCGCACAAATGAGCCGGAAACCGGAAGGCTGG
ACGGAACTGTCCGGCTGGTACCGCCTCTTTGCCGGCGCACGTAAAGCCTT
GGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy