Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap rRNA-5S-1 rRNA-23S-1 IGR0945 IGR0943.1 IGR0944 IGR0949.1 IGR0946 IGR0947 IGR0949 IGR0943 IGR0948 IGR948.1 IGR0950 NG1172 NG1169 NG1167.1 NG1168 comE, - NG1178 vsr, - NG1173 pil, - NG1177 dcm, - NG1175 NG1174 NG1171 NG1176 NG1172 NG1169 NG1167.1 NG1168 comE, - NG1178 vsr, - NG1173 pil, - NG1177 dcm, - NG1175 NG1174 NG1171 NG1176 Type: direct, Name:  - 114 Type: direct, Name:  - 106 Type: direct, Name:  - 124 Type: direct, Name:  - 110 Type: direct, Name:  - 113 Type: direct, Name:  - 121 NG1168 comE, - NG1178 vsr, - NG1173 pil, - NG1177 dcm, - NG1175 NG1174 NG1171 NG1170 NG1172 NG1167.1 NG1169 NG1170 NG1176
* Calculated from Protein Sequence

Gene ID: NG1175

DNA Molecule Name:
1  

Genomic Island ID:
6

Genbank ID:


Gene Name:
dcm  

Definition:
cytosine specific DNA methyltransferase

Gene Start:
1113534

Gene Stop:
1112989

Gene Length:
546

Molecular Weight*:
20530

pI*:
9.90

Net Charge*:
7.77

EC:
2.1.1.73  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Hepburn PA, Margison GP, Tisdale MJ.
Enzymatic methylation of cytosine in DNA is prevented by adjacent O6-methylguanine residues.
J Biol Chem. 1991 May;266(13):7985-7.
PMID: 2022628

Ibáñez M, Alvarez I, Rodríguez-Peña JM, Rotger R.
A ColE1-type plasmid from Salmonella enteritidis encodes a DNA cytosine methyltransferase.
Gene. 1997 Sep;196(1-2):145-58.
PMID: 9322752

Klimasauskas S, Timinskas A, Menkevicius S, Butkienè D, Butkus V, Janulaitis A.
Sequence motifs characteristic of DNA[cytosine-N4]methyltransferases: similarity to adenine and cytosine-C5 DNA-methylases.
Nucleic Acids Res. 1989 Dec;17(23):9823-32.
PMID: 2690010

Comment:


Blast Summary:  PSI-Blast Search
Residues 6-181 are 60% similar to residues 169-338 in X55141, a site-specific DNA-methyltransferase (cytosine-specific).

Residues 92-178 are 48% similar to residues 259-344 in AE001477, Type II DNA modification enzyme (methyltransferase) from Helicobacter pylori J99.


COGS Summary:  COGS Search
BeTs to 7 clades of COG0270
COG name: Site-specific DNA methylase dcm
Functional Class:  L
The phylogenetic pattern of COG0270 is -Mtk---ceB-hUJ-------
Number of proteins in this genome belonging to this COG is 8

Blocks Summary:  Blocks Search
***** IPB001525 (C-5 cytosine-specific DNA methylase) with a combined E-value of 1.5e-08.
    IPB001525E    129-144
    IPB001525F    157-166


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG1175 is paralogously related to NG1894 (5-methylcytosine methyltransferase) (1e-11), NG0365 (site-specific DNA-methyltransferase (cytosine-specific) NgoVII) (3e-07), NG1795 (site-specific DNA-methyltransferase (cytosine-specific)) (5e-04) and NG0873 (DNA modification methylase) (7e-04).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1DCT|1DCT-A DNA (CYTOSINE-5) METHYLASE FROM HAEIII 89.7 3e-19
pdb|10MH|10MH-A TERNARY STRUCTURE OF HHAI METHYLTRANSFERASE WITH 38.3 0.001000
pdb|1FJX|1FJX-A STRUCTURE OF TERNARY COMPLEX OF HHAI 38.3 0.001000
pdb|1DCT|1DCT-A

Gene Protein Sequence:
IYVNCKQNNQKKLEPVKYSGKRLTVRDVLGMENGFPKIMAGHQDETDFMH
SCAGLSDINLKRLALIPKNGGNRLAFAHIPELQLECFIGKDNSFKDTFGR
LWWDKPAPTITTKFFSISNGRFAHPEEDRALSLREGATLQSFPRNYVFKA
GSRDKIARLIGNAVPPMYTEKIGRAIVDNIEC

Gene Nucleotide Sequence:  Sequence Viewer
ATTTACGTTAATTGCAAACAGAATAACCAAAAAAAGCTGGAACCAGTCAA
GTATTCGGGCAAACGGCTTACGGTACGCGATGTTTTGGGAATGGAAAACG
GCTTTCCCAAAATTATGGCAGGACATCAAGACGAGACGGATTTTATGCAT
AGTTGTGCGGGATTATCCGATATCAATTTGAAACGATTGGCTTTGATACC
TAAAAACGGAGGAAACCGTTTGGCTTTTGCGCATATTCCCGAATTACAGC
TGGAATGTTTTATCGGAAAAGACAATAGTTTTAAAGACACGTTCGGTAGG
CTATGGTGGGATAAGCCCGCACCTACCATAACGACCAAATTCTTTAGCAT
TTCCAACGGGCGGTTTGCCCATCCTGAAGAAGATAGGGCGTTATCCCTGC
GAGAAGGTGCAACATTGCAATCGTTCCCTCGTAACTATGTCTTTAAAGCG
GGCAGTAGGGACAAGATAGCCCGTTTGATTGGTAATGCCGTTCCTCCGAT
GTATACGGAAAAAATAGGCAGGGCAATTGTTGATAATATCGAATGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy