Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Glu-3 IGR0940.1 IGR0939 IGR0936 IGR0937 IGR0933 IGR0938 IGR0940 IGR0934 IGR0935 IGR0932 IGR0940.2 NG1159 pivNg, - NG1163.1 NG1155 pivNg, - NG1164 NG1156 tehB, - NG1161 NG1165 NG1158 NG1163 rnh, - NG1162 tpn, - NG1157 thiD, - NG1160 NG1159 pivNg, - NG1163.1 NG1155 pivNg, - NG1164 NG1156 tehB, - NG1161 NG1165 NG1158 NG1163 rnh, - NG1162 tpn, - NG1157 thiD, - NG1160 Type: inverse, Name:  - 166 Type: direct, Name:  - 100 Type: inverse, Name:  - 181 Type: inverse, Name:  - 161 Type: direct, Name:  - 122 Type: inverse, Name:  - 160 Type: direct, Name:  - 136 Type: direct, Name:  - 125 NG1159 pivNg, - NG1163.1 NG1155 pivNg, - NG1164 NG1156 tehB, - NG1161 NG1165 NG1158 rnh, - NG1162 tpn, - NG1157 thiD, - NG1160 NG1163
* Calculated from Protein Sequence

Gene ID: NG1160

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
thiD  

Definition:
phosphomethylpyrimidine kinase (ThiD)

Gene Start:
1100406

Gene Stop:
1101209

Gene Length:
804

Molecular Weight*:
28339

pI*:
6.70

Net Charge*:
-1.41

EC:
2.7.4.7  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Thiamine  

Pathway: pathway table
Thiamine metabolism

Secondary Evidence:
Mizote,T., Tsuda,M., Smith,D.D., Nakayama,H. and Nakazawa,T.
Cloning and characterization of the thiD/J gene of Escherichia coli encoding a thiamin-synthesizing bifunctional enzyme,
hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase
Microbiology 145 (Pt 2), 495-501 (1999)
M:99173753


Comment:
Oklahoma ID: NGO.1160

For other 'thi' genes, see NG2041 (thiC), NG1575 (thiL), NG2005 (thiG), NG2007 (thiE), NG2008 (thiO), NG2019 (thiF).

Blast Summary:  PSI-Blast Search
Residues 1-268 in NG1160 have 96% similarity to residues 1-268 in AL162757, N. meningitidis Z2491 phosphomethylpyrimidine kinase.
NG1160 also has strong similarity (P-value < 1e-60) to thiD proteins in several other organisms, e.g. residues 7-266 are 66% similar to THID_HAEIN (1175242).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0351
COG name: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase
Functional Class:  H
The phylogenetic pattern of COG0351 is amtkYqv-eBrhuj---l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 115-255 are 60% similar to a (KINASE TRANSFERASE PROTEIN PUTATIVE) protein domain (PD000850) which is seen in THID_HAEIN.

Residues 26-112 are 68% similar to a (PROTEIN KINASE THIAMINE BIOSYNTHESIS) protein domain (PD003501) which is seen in THID_HAEIN.



Paralogs:  Local Blast Search


NG1160 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1JXH|1JXH-A 4-AMINO-5-HYDROXYMETHYL-2-METHYLPYRIMIDINE 176.0 3e-45
pdb|1GQT|1GQT-A ACTIVATION OF RIBOKINASE BY MONOVALENT CATIONS 58.2 2e-09
pdb|1LHP|1LHP-A CRYSTAL STRUCTURE OF PYRIDOXAL KINASE FROM SHEEP 41.4 2e-04
pdb|1JXH|1JXH-A 4-AM

Gene Protein Sequence:
MKGSFVQTLAIAGSDSGGGAGIQADLKTFQMRGVFGTCVITAVTAQNTLG
VSAVHLVPTETITAQIQAIREDFDIRAYKIGMLGTAEIIECVADKLKHCS
FGRRVLDPVMIAKGGAPLLQDSAVAALTRLLLPDTDILTPNLPEAEALTG
VHIENRKDAERAAKILLDYGVKNVIIKGGHLNGSTSGRCTDWLFTQNETL
ELDSPRFPTAHTHGTGCTFSACITAELAKGLDVCKAVQTAKAYITAAISN
PLEIGAGHGPVNHWAYRD

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGGCTCTTTTGTGCAGACGCTTGCCATCGCCGGTTCGGATTCGGG
CGGCGGTGCGGGCATTCAGGCGGATTTGAAAACGTTTCAGATGCGCGGCG
TGTTCGGAACGTGTGTCATCACCGCCGTTACCGCGCAAAATACCTTGGGC
GTGTCGGCGGTTCATCTCGTCCCGACCGAAACCATCACCGCACAAATCCA
AGCAATCAGGGAAGACTTTGACATCCGCGCCTACAAAATCGGTATGCTCG
GCACGGCGGAAATCATCGAATGCGTTGCCGACAAGCTGAAACACTGCAGC
TTTGGCAGGCGCGTACTCGACCCTGTGATGATTGCCAAAGGCGGTGCGCC
GCTGTTGCAGGATTCCGCCGTTGCGGCACTGACGCGCCTGCTGCTGCCGG
ACACGGACATCCTGACCCCCAACCTGCCCGAGGCGGAAGCCTTGACGGGC
GTGCATATCGAAAACCGTAAAGATGCGGAACGTGCGGCAAAAATCCTGCT
TGATTACGGTGTCAAAAATGTCATTATCAAAGGCGGACATTTGAACGGCA
GCACAAGCGGACGCTGCACGGATTGGCTGTTTACGCAAAACGAAACGCTG
GAATTGGACAGCCCGCGCTTTCCGACTGCCCACACGCACGGCACGGGCTG
CACGTTTTCCGCCTGCATTACCGCCGAGTTGGCAAAAGGCTTAGACGTTT
GCAAAGCCGTACAGACTGCCAAGGCCTACATCACGGCGGCAATCTCAAAC
CCTTTGGAAATCGGCGCGGGACACGGGCCGGTCAATCATTGGGCGTATCG
GGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy