Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0931.1 IGR0930 IGR0933 IGR0927 IGR0931.2 IGR0929 IGR0928 IGR0931 IGR0934 IGR0926 IGR0932 NG1148 NG1155 NG1150 NG1156 metZ, - NG1149 NG1146 NG1151 fumB, - NG1153.1 tpn, - NG1157 hisJ, - NG1152 fumA, - NG1153 trkA, - NG1154 NG1148 NG1155 NG1150 NG1156 metZ, - NG1149 NG1146 NG1151 fumB, - NG1153.1 tpn, - NG1157 hisJ, - NG1152 fumA, - NG1153 trkA, - NG1154 Type: inverse, Name:  - 181 NG1155 NG1150 NG1156 metZ, - NG1149 NG1147 NG1146 NG1148 NG1147 NG1151 fumB, - NG1153.1 tpn, - NG1157 hisJ, - NG1152 fumA, - NG1153 trkA, - NG1154
* Calculated from Protein Sequence

Gene ID: NG1153

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fumA  

Definition:
fumarate hydratase (alpha subunit)

Gene Start:
1092565

Gene Stop:
1093479

Gene Length:
915

Molecular Weight*:
32990

pI*:
4.90

Net Charge*:
-9.06

EC:
4.2.1.2  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Citrate cycle (TCA cycle)
Reductive carboxylate cycle (CO2 fixation)

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-287 are 38% similar to AE000756, a fumarate hydratase (fumarase) from Aquifex aeolicus.

Residues 1-290 are 38% similar to AJ131242, a fumarate hydratase B, alpha subunit from Wolinella succinogenes.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1951
COG name: Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domain
Functional Class:  C
The phylogenetic pattern of COG1951 is amTk-qv-E------------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG1153 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 290 (E-value = 3.7e-159) place NG1153 in the Fumerase family which is described as Fumarate hydratase (Fumerase) (PF05681)

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTVIKQEDFIQSICDAFQFISYYHPKDYIDALYKAWQKEENPAAKDAMTQ
ILVNSRMCAENNRPICQDTGIATVFLKVGMDVQWDADMSVEKMVNEGVRR
AYTWEGNTLRASVLADPAGKRQNTKDNTPAVIHMSIVPGGKVEVTCAAKG
GGSENKSKLAMLNPSDNIVDWVLKTIPTMGAGWCPPGILGIGIGGTPEKA
VLMAKESLMSHIDIQELQEKAASGAELSTTEALRLELFEKVNALGIGAQG
LGGLTTVLDVKILDYPTHAASKPIAMIPNCAATRHVEFELDGSGPVELTP
PRVED

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGTTATCAAGCAAGAAGACTTTATTCAAAGTATCTGCGATGCCTT
CCAATTCATCAGCTACTACCATCCAAAAGACTACATCGACGCGCTTTATA
AGGCGTGGCAGAAGGAAGAAAATCCCGCCGCCAAAGACGCGATGACGCAG
ATTTTGGTCAACAGCCGTATGTGTGCCGAAAACAACCGCCCCATCTGCCA
AGACACAGGTATCGCAACCGTCTTCCTCAAAGTCGGTATGGATGTGCAAT
GGGATGCGGACATGAGCGTGGAAAAGATGGTTAACGAAGGCGTACGCCGC
GCCTACACTTGGGAAGGCAACACCCTGCGCGCTTCCGTCCTCGCCGATCC
GGCCGGCAAACGCCAAAACACCAAAGACAACACCCCCGCCGTCATCCACA
TGAGCATCGTGCCGGGCGGTAAAGTCGAAGTAACCTGCGCGGCAAAAGGC
GGCGGCTCTGAAAACAAATCCAAACTCGCTATGCTCAACCCTTCCGACAA
CATCGTCGATTGGGTATTGAAAACCATCCCGACGATGGGCGCGGGCTGGT
GTCCTCCCGGCATCTTGGGCATCGGCATCGGCGGCACGCCCGAAAAAGCC
GTGTTGATGGCGAAAGAATCCCTGATGAGCCACATCGACATCCAAGAATT
GCAGGAAAAAGCCGCGTCCGGCGCGGAATTGTCCACCACCGAAGCCCTGC
GCCTCGAACTCTTTGAAAAGGTCAACGCGCTGGGCATCGGCGCGCAAGGC
TTGGGCGGTCTGACCACCGTGTTGGACGTGAAAATCCTCGATTACCCGAC
CCATGCCGCCTCCAAACCGATTGCCATGATTCCCAACTGTGCCGCCACCC
GCCACGTCGAATTTGAATTGGACGGCTCAGGTCCTGTCGAACTCACGCCG
CCGCGCGTCGAAGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy