Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0931.1 IGR0922 IGR0924 IGR0930 IGR0925 IGR0923 IGR0927 IGR0931.2 IGR0929 IGR0921 IGR0928 IGR0931 IGR0926 NG1144 NG1148 NG1143 NG1142 NG1145 NG1150 metZ, - NG1149 NG1146 tspB, - NG1140 NG1151 fumB, - NG1153.1 hisJ, - NG1152 fumA, - NG1153 trkA, - NG1154 NG1144 NG1148 NG1143 NG1142 NG1145 NG1150 metZ, - NG1149 NG1146 tspB, - NG1140 NG1151 fumB, - NG1153.1 hisJ, - NG1152 fumA, - NG1153 trkA, - NG1154 Type: direct, Name:  - 100 Type: direct, Name:  - 103 Type: direct, Name:  - 127 NG1148 NG1145 NG1150 metZ, - NG1149 NG1146 tspB, - NG1140 NG1147 NG1141 NG1147 NG1142 NG1141 NG1143 NG1144 NG1151 fumB, - NG1153.1 hisJ, - NG1152 fumA, - NG1153 trkA, - NG1154
* Calculated from Protein Sequence

Gene ID: NG1149

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
metZ  

Definition:
O-succinylhomoserine sulfhydrolase

Gene Start:
1090131

Gene Stop:
1088974

Gene Length:
1158

Molecular Weight*:
41562

pI*:
7.30

Net Charge*:
1.09

EC:
4.2.99.-  

Functional Class:
Amino acid biosynthesis; Aspartate family  

Pathway: pathway table

Comment:
See also NG2027, methionine biosynthesis transcriptional regulator (MetR). In addition, other 'met' genes include: NG2044, metG/metS; NG0928, metE; NG0933, metX; NG0929, metF; NG0386, metC/metB2; and NG0106, metK, all involved in methionine biosynthesis.

Oklahoma ID: NGO.1149c

Blast Summary:  PSI-Blast Search
Residues 1-386 in NG1149 have 96% similarity to residues 1-389 in AL162757, N. meningitidis Z2491 O-succinylhomoserine sulfhydrolase.
NG1149 also has very strong similarity (P-value < 1e-70) to metZ proteins in other organisms, e.g. residues 9-385 are 50% similar to the enzyme from P.alcaligenes (3978474).

COGS Summary:  COGS Search
BeTs to 7 clades of COG0626
COG name: Cystathionine beta-lyases/cystathionine gamma-synthases
Functional Class:  E
The phylogenetic pattern of COG0626 is ---kY-VcEBRHuj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000277 (Cys/Met metabolism pyridoxal-phosphate-dependent enzymes) with a combined E-value of 1.6e-89.
    IPB000277A    52-73
    IPB000277B    145-178
    IPB000277C    182-217
    IPB000277D    238-278
    IPB000277E    330-346
    IPB000277F    363-380


ProDom Summary:  Protein Domain Search
Residues 9-384 are 47% similar to a (PYRIDOXAL PHOSPHATE AMINOTRANSFERASE TRANSFERASE PROTEIN) protein domain (PD000087) which is seen in METZ_PSEAE.



Paralogs:  Local Blast Search


NG1149 is paralogously related to NG0386 (probable cystathionine beta/gamma-lyase (probable cystathionine gamma-synthase)) (1e-50).


Pfam Summary:  Pfam Search
Residues 8 to 385 (E-value = 5e-170) place NG1149 in the Cys_Met_Meta_PP family which is described as Cys/Met metabolism PLP-dependent enzyme (PF01053)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
125  
232
transmembrane  
165  
181

PDB Hit:
pdb|1E5E|1E5E-A METHIONINE GAMMA-LYASE (MGL) FROM TRICHOMONAS 250.0 2e-67
pdb|1GC0|1GC0-A CRYSTAL STRUCTURE OF THE PYRIDOXAL-5'-PHOSPHATE 241.0 2e-64
pdb|1IBJ|1IBJ-A CRYSTAL STRUCTURE OF CYSTATHIONINE BETA-LYASE 233.0 4e-62
pdb|1I41|1I41-A CYST

Gene Protein Sequence:
MSKKLHPQTLAIRGGKEQTGYREHNQALFLTSSFMWDNAQHAADLFSKKI
KGFTYTRTANPTIAAFEKRIAALEGAERAVATSTGMSAIQAAFFTFLQAG
DHVVSSRSLFGTTVGFINNIVTKFGIGVSRVSPTDINEWKAAVKANTKLL
FLETPSNPLGEVADLEALAELAHGIGALLVVDNSLLSPVGSQPLKHGADI
SVSSATKAIDGHGRVMGGVLAGSEELMAQVAVYCNSCGLAMSPFNAWQLL
SGVETLSLRMEKQFDNALRIAQWLQEQPQVQAVYYTGLPDHPQAELIRKQ
QNGGGIVIGFEVADQAAAWKVVELFSRTANLGDVRSTITNPWTTTHGRMQ
PEEKLAAGIRPGLVRLSVGLEYVGDLIDDLKQALAR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAAAAAACTTCATCCGCAAACGCTCGCCATACGCGGCGGCAAAGA
ACAAACCGGATACCGCGAACACAATCAGGCATTGTTCCTGACCAGCAGCT
TCATGTGGGACAACGCCCAACACGCTGCCGATTTGTTTTCAAAAAAAATC
AAAGGCTTCACTTATACCCGTACCGCCAACCCGACCATCGCGGCCTTTGA
AAAACGCATAGCCGCTTTGGAAGGCGCGGAACGCGCGGTCGCCACTTCGA
CCGGCATGTCCGCGATTCAGGCGGCGTTTTTCACCTTCCTGCAGGCGGGC
GACCATGTGGTTTCCAGCCGCAGCCTGTTCGGCACGACCGTCGGCTTTAT
CAATAACATCGTTACCAAATTCGGCATCGGAGTGAGCCGCGTGTCGCCGA
CTGATATAAATGAATGGAAAGCCGCCGTCAAAGCCAACACCAAACTGCTG
TTTTTGGAAACGCCGTCCAACCCCTTGGGCGAAGTGGCCGACTTGGAAGC
CTTGGCGGAATTGGCGCACGGCATCGGCGCGCTCTTGGTGGTGGACAACA
GCCTGCTGTCGCCCGTCGGCTCGCAGCCTTTGAAACACGGCGCGGATATT
TCCGTTTCCTCCGCCACCAAAGCCATAGACGGACACGGGCGCGTGATGGG
CGGCGTGTTGGCGGGTTCGGAAGAACTGATGGCGCAGGTCGCCGTTTACT
GCAACTCTTGCGGTTTGGCGATGTCGCCGTTTAACGCGTGGCAGTTGTTG
AGCGGCGTGGAAACCCTGTCGCTGCGTATGGAAAAACAGTTTGACAACGC
CTTGAGAATCGCGCAATGGCTGCAAGAGCAGCCGCAGGTTCAAGCAGTGT
ACTACACCGGATTGCCCGACCATCCGCAGGCGGAGCTTATCCGCAAACAG
CAAAACGGCGGCGGCATCGTCATCGGTTTTGAAGTCGCCGACCAAGCAGC
CGCGTGGAAAGTCGTGGAACTCTTTTCCCGTACCGCCAACCTCGGCGACG
TGCGCTCGACCATCACCAATCCGTGGACAACCACGCACGGCAGGATGCAG
CCCGAAGAAAAACTCGCCGCCGGTATCCGCCCCGGACTGGTGCGCCTGTC
GGTCGGTTTGGAATATGTTGGCGATTTGATTGACGATTTGAAACAGGCAC
TCGCGCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy