Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0894 IGR0905 IGR0899 IGR0906 IGR0898 IGR0897 IGR0893 IGR0902 IGR0900 IGR0896 IGR0904 IGR0901 IGR0895 IGR0903 NG1106 NG1114 NG1115 NG1119 NG1112 NG1100 NG1109 NG1104 NG1101 NG1108 NG1102 NG1111 NG1098 dnaB, - NG1110 NG1113 NG1118 NG1107 NG1117 NG1105 prtR, - NG1116 NG1106 NG1114 NG1115 NG1119 NG1112 NG1100 NG1109 NG1104 NG1101 NG1108 NG1102 NG1111 NG1098 dnaB, - NG1110 NG1113 NG1118 NG1107 NG1117 NG1105 prtR, - NG1116 Type: inverse, Name:  - 159 Type: inverse, Name:  - 171 Type: tandem, Name:  - 53 Type: inverse, Name:  - 153 Type: inverse, Name:  - 173 Type: inverse, Name:  - 176 Type: tandem, Name:  - 51 Type: inverse, Name:  - 164 Type: inverse, Name:  - 156 Type: inverse, Name:  - 152 Type: tandem, Name:  - 52 Type: inverse, Name:  - 163 Type: inverse, Name:  - 147 Type: tandem, Name:  - 54 NG1106 NG1115 NG1119 NG1112 NG1108 NG1111 dnaB, - NG1110 NG1099 NG1103 NG1104 NG1102 NG1098 NG1114 NG1109 NG1103 NG1101 NG1100 NG1099 NG1113 NG1107 NG1117 NG1105 prtR, - NG1116 NG1118
* Calculated from Protein Sequence

Gene ID: NG1110

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaB  

Definition:
replicative DNA helicase, phage origin

Gene Start:
1067850

Gene Stop:
1066492

Gene Length:
1359

Molecular Weight*:
49522

pI*:
5.30

Net Charge*:
-8.74

EC:
3.6.1.-  

Functional Class:
Other categories; Phage-related functions and prophages  
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Folate biosynthesis
Starch and sucrose metabolism

Secondary Evidence:
Wong,A., Kean,L. and Maurer,R. Sequence of the dnaB gene of Salmonella typhimurium . J. Bacteriol. 170 (6): 2668-2675 (1988) [Medline: 88227847].

Nakayama,N., Arai,N., Bond,M.W., Kaziro,Y. and Arai,K. Nucleotide sequence of dnaB and the primary structure of the dnaB protein from Escherichia coli. The Journal of biological chemistry. 259 (1): 97-101 (1984) [Medline: 84161990].

Comment:
Oklahoma ID: NGO.1110c

From GenBANK (gi:1169367): In H. influenzae, DnaB participates in initiation and elongation during chromosome replication; it exhibits DNA-dependent ATPase activity and contains distinct active sites for ATP binding, DNA binding, and interaction with DnaC protein, primase, and other prepriming proteins. This homohexamer belongs to the DnaB subfamily of helicases.

For other 'dna' genes, see NG0002 (dnaN), NG0078 (dnaE), NG0235 (dnaJ), NG0451 (dnaB), NG0485 (dnaB), NG0551 (dnaJ), NG0973 (dnaQ), NG0998 (dnaG), NG0001 (dnaA), NG1429 (dnaK), NG1636 (dnaC) and NG1901 (dnaJ).

Blast Summary:  PSI-Blast Search
NG1110 is orthologous to AE002441, N. meningitidis MC58 replicative DNA helicase: residues 23-468 have 34% similarity to residues 15-466 in NG1110.

Numerous significant hits to replicative DNA helicase proteins in gapped BLAST; e.g. residues 15-433 are 36% similar to gb|AAF83171.1|AE003888_4 replicative DNA helicase of Xylella fastidiosa, residues 15-432 are 34% similar to emb|CAB16081.1| replicative DNA helicase of Bacillus subtilis, residues 15-432 are 35% similar to 10176654 replicative DNA helicase of Bacillus halodurans.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0305
COG name: Replicative DNA helicase
Functional Class:  L
The phylogenetic pattern of COG0305 is -----qvCeBRhujgpOlinx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001198 (DnaB helicase) with a combined E-value of 2.8e-62.
    IPB001198B    98-114
    IPB001198C    188-226
    IPB001198D    233-272
    IPB001198E    311-324
    IPB001198F    328-376
    IPB001198G    407-432


ProDom Summary:  Protein Domain Search
Residues 38-375 are 32% similar to a (HELICASE DNA REPLICATIVE REPLICATION) protein domain (PD002663) which is seen in DNAC_BACSU.

Residues 376-432 are 49% similar to a (HELICASE DNA REPLICATIVE REPLICATION) protein domain (PD003017) which is seen in O84505_CHLTR.



Paralogs:  Local Blast Search


NG1110 is paralogously related to NG0485 (replicative DNA helicase) (0.0), NG0451 (replicative DNA helicase) (3e-68) and NG0367 (DNA repair protein) (4e-05).


Pfam Summary:  Pfam Search
Residues 11 to 112 (E-value = 6.6e-30) place NG1110 in the DnaB family which is described as DnaB-like helicase N terminal domain (PF00772)
Residues 182 to 375 (E-value = 8e-40) place NG1110 in the DnaB_C family which is described as DnaB-like helicase C terminal domain (PF03796)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
22  
38
non-globular  
107  
234

PDB Hit:
pdb|1JWE|1JWE-A NMR STRUCTURE OF THE N-TERMINAL DOMAIN OF E. 83.9 5e-17
pdb|1B79|1B79-A N-TERMINAL DOMAIN OF DNA REPLICATION PROTEIN 81.1 4e-16
pdb|1CR0|1CR0-A CRYSTAL STRUCTURE OF THE HELICASE DOMAIN OF THE 50.4 6e-07
pdb|1E0J|1E0J-A GP4D

Gene Protein Sequence:
MNRIEETEAVQSLASVGAEQNILGGILIEPTAIARCAILTPEKFYQAQHR
IIFRALLDMAAANEPIDIITLNDKLEARGEAENAGGLAYLIDLNQNTPSA
KNISRYVGIVNDRFVERGLLKASAAIEKIAVSKDGGTVAEKLSKAADELA
AVGKDAVKRETKTFGQTVEDLIGGLDKRLDGVRFGLPTGLMKLDGMTGGL
PDGNLIVIAARPSMGKTVLAENIARFALKQGKAVHFQSYEMSAVELARRG
MAAECNIPMQNLKTGNLTQSDYANMPIYVSQAKEWKFDVNCDLLNVDELC
FLAKEKKLTTGLDLLVVDHLHIMPRAGRDEVAELGNISRRLKNLAAELNT
PVVLVAQLNRGNTKQADKRPNMADIRGSGAIEQDANIIIMPHRESYYDGN
ENPSIAELIIAKNRDGEMGTVVCGWKGQFMKFEEEPDLAWQAPKHDEYDP
YSV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCGAATCGAGGAAACGGAAGCCGTCCAATCACTGGCCAGCGTAGG
GGCGGAACAGAACATTTTGGGCGGCATCTTGATTGAACCGACGGCGATTG
CGCGGTGCGCAATCCTGACCCCTGAAAAGTTTTACCAGGCGCAACACAGG
ATTATTTTCCGCGCTCTGCTGGATATGGCGGCGGCAAACGAGCCTATCGA
CATCATCACGCTGAACGACAAGCTGGAAGCGCGCGGCGAGGCGGAAAACG
CGGGTGGCCTGGCTTACTTGATAGACCTGAACCAAAACACCCCAAGCGCG
AAGAATATCAGCCGGTACGTTGGGATTGTGAACGACAGGTTTGTCGAGCG
CGGCTTGCTGAAGGCTTCGGCGGCGATTGAAAAAATCGCGGTTTCCAAAG
ACGGCGGGACGGTCGCAGAAAAGCTGTCTAAGGCGGCCGATGAATTGGCG
GCAGTCGGCAAAGACGCGGTAAAGCGTGAAACCAAGACATTCGGCCAGAC
CGTTGAGGATTTGATTGGCGGTTTGGACAAAAGGCTTGACGGCGTGCGTT
TCGGATTGCCTACCGGCTTGATGAAGCTTGACGGGATGACCGGCGGTTTG
CCGGATGGAAACCTGATTGTGATTGCGGCGCGTCCGTCTATGGGTAAAAC
GGTTTTGGCGGAAAACATTGCGCGATTCGCGCTGAAGCAGGGCAAGGCAG
TTCATTTCCAAAGCTACGAAATGAGCGCGGTAGAGCTGGCAAGGCGCGGC
ATGGCGGCTGAGTGCAATATCCCCATGCAGAACCTGAAAACCGGCAATCT
GACGCAAAGCGATTACGCCAATATGCCGATTTACGTCAGCCAAGCGAAAG
AGTGGAAGTTTGACGTGAACTGCGACCTGCTCAACGTTGACGAGCTTTGC
TTTTTGGCTAAGGAGAAAAAACTCACTACCGGCTTGGATTTGTTGGTTGT
CGATCACCTTCACATCATGCCAAGGGCAGGGAGGGACGAGGTGGCGGAGT
TGGGGAATATATCGCGCCGTTTGAAAAACTTGGCGGCAGAGCTGAATACC
CCCGTCGTCTTGGTTGCCCAGTTGAACAGGGGAAACACAAAGCAGGCAGA
CAAACGCCCGAACATGGCAGACATTCGCGGCAGCGGCGCGATTGAGCAAG
ACGCAAACATCATCATCATGCCGCACCGCGAAAGCTACTACGACGGAAAC
GAGAATCCGAGCATTGCCGAGCTGATTATCGCCAAGAACCGGGACGGCGA
AATGGGAACGGTGGTTTGCGGCTGGAAAGGGCAATTTATGAAGTTCGAGG
AAGAGCCTGATTTGGCATGGCAAGCCCCCAAACATGATGAATATGACCCT
TACAGTGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy