Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0876 IGR0877 IGR0878 IGR0882 IGR0880 IGR0879 IGR0874.2 IGR0875 IGR0881 NG1077 ydfG, - NG1079 lst, - NG1081 NG1084 NG1083 yciA, - NG1078 cyc, - NG1080 opaH,opaK, - NG1076 NG1075 idh, - NG1082 NG1077 ydfG, - NG1079 lst, - NG1081 NG1084 NG1083 yciA, - NG1078 cyc, - NG1080 opaH,opaK, - NG1076 NG1075 idh, - NG1082 Type: tandem, Name:  - 46 Type: tandem, Name:  - 47 Type: tandem, Name:  - 48 NG1077 ydfG, - NG1079 lst, - NG1081 NG1084 NG1083 yciA, - NG1078 cyc, - NG1080 opaH,opaK, - NG1076 NG1075 idh, - NG1082
* Calculated from Protein Sequence

Gene ID: NG1081

DNA Molecule Name:
1  

Genbank ID:
1546001

Gene Name:
lst  

Definition:
alpha-2,3-sialyltransferase (lipooligosaccharide sialyltransferase) (CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase)

Gene Start:
1039966

Gene Stop:
1038833

Gene Length:
1134

Molecular Weight*:
43393

pI*:
9.70

Net Charge*:
10.27

EC:
2.4.99.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Blood group glycolipid biosynthesis - neolact series
Lipopolysaccharide biosynthesis
Sphingoglycolipid metabolism

Primary Evidence:
Gilbert,M., Watson,D.C., Cunningham,A.M., Jennings,M.P., Young,N.M. and Wakarchuk,W.W.,
Cloning of the lipooligosaccharide alpha-2,3-sialyltransferase from the bacterial pathogens Neisseria meningitidis and Neisseria
gonorrhoeae,
J. Biol. Chem. 271 (45), 28271-28276 (1996)
Medline: 97067044.

Comment:
From GenBANK (gi:14285523): Lst of N.gonorrhoeae transfers sialic acid from the substrate CMP-sialic acid donor to the terminal beta-d-galactosyl-1,4-acetyl-beta-d-glucosamine on the lacto-n-neotetraose branch of the lipooligosaccharide, by the reaction: CMP-n-acetylneuraminate + beta-d-galactosyl-1,4-acetyl-beta-d-glucosamine = CMP + alpha-n-acetylneuraminyl-2,3-beta-d-galactosyl-1,
4-n-acetyl-beta-d-glucosamine. This is involved in the pathway for lipopolysaccharide biosynthesis. Lst belongs to the glycosyltransferase family 52.

Oklahoma ID: NGO.1081c

Blast Summary:  PSI-Blast Search
NG1081 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1546001, alpha-2,3-sialyltransferase.

Several significant hits in gapped BLAST to alpha-2,3-sialyltransferases; e.g. residues 50-340 are 31% similar to 14285526 of Pasteurella multocida.

Residues 1-371 are 95% similar to 14285527, CMP-N- acetylneuraminate- beta-galactosamide-alpha- 2,3-sialyltransferase, of N.meningitidis.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 50-345 are identical to a (SIALYLTRANSFERASE) protein domain (PD017777) which is seen in P72074_NEIGO.

Residues 346-371 are 96% similar to a (SIALYLTRANSFERASE) protein domain (PD040505) which is seen in P72074_NEIGO.

Residues 1-49 are identical to a (SIALYLTRANSFERASE) protein domain (PD040507) which is seen in P72074_NEIGO.



Paralogs:  Local Blast Search


NG1081 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
22
transmembrane  
6  
22

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MGLKKVCLTVLCLIVFCFGIFYTFDRVNQGERNAVSLLKDKLFNEEGKPV
NLIFCYTILQMKVAERIMAQHPGERFYVVLMSENRNEKYDYYFNQIKDKA
ERAYFFYLPYGLNKSFNFIPTMAELKVKSMLLPKVKRIYLASLEKVSIAA
FLSTYPDAEIKTFDDGTNNLIRESSYLGGEFAVNGAIKRNFARMMVGDWS
IAKTRNASDEHYTIFKGLKNIMDDGRRKMTYLPLFDASELKAGDETGGTV
RILLGSPDKEMKEISEKAAKNFNIQYVAPHPRQTYGLSGVTALNSPYVIE
DYILREIKKNPHTRYEIYTFFSGAALTMKDFPNVHVYALKPASLPEDYWL
KPVYALFRQADIPILAFDDKNQSHGKSK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGGTTGAAAAAAGTCTGTTTGACCGTGTTGTGCCTGATTGTTTTTTG
CTTCGGGATATTTTATACGTTTGACCGGGTAAATCAGGGGGAAAGGAACG
CGGTTTCCCTGCTGAAGGACAAACTCTTCAATGAAGAGGGGAAACCCGTC
AATCTGATTTTCTGCTATACCATATTGCAGATGAAGGTGGCAGAAAGGAT
TATGGCGCAGCATCCGGGGGAGCGGTTTTATGTGGTGCTGATGTCTGAAA
ACAGGAATGAAAAATACGATTATTATTTCAATCAGATAAAGGATAAGGCG
GAGCGGGCGTATTTTTTCTACCTGCCCTACGGTTTGAACAAATCGTTTAA
TTTCATTCCGACGATGGCGGAGCTGAAGGTGAAGTCGATGCTGCTGCCGA
AGGTCAAGCGGATTTATTTGGCGAGTTTGGAAAAAGTCAGTATTGCCGCC
TTTTTGAGCACTTACCCGGATGCGGAAATCAAAACCTTTGACGACGGCAC
AAACAACCTGATACGGGAGAGCAGCTATTTGGGCGGCGAGTTTGCCGTAA
ACGGGGCGATTAAGCGGAATTTTGCCCGAATGATGGTCGGGGATTGGAGC
ATCGCCAAAACCCGCAATGCTTCCGACGAGCATTACACGATATTCAAGGG
TTTGAAAAACATTATGGATGACGGCCGCCGCAAGATGACTTACCTGCCGC
TGTTCGATGCGTCCGAACTGAAGGCGGGGGACGAAACGGGCGGCACGGTG
CGGATACTTTTGGGTTCGCCCGACAAAGAGATGAAGGAAATTTCGGAAAA
GGCGGCAAAAAATTTCAACATACAATATGTCGCGCCGCATCCCCGCCAGA
CCTACGGGCTTTCCGGCGTAACCGCGTTAAATTCGCCCTATGTCATCGAA
GACTATATTTTGCGCGAAATTAAGAAAAACCCGCATACGAGGTATGAAAT
TTATACCTTTTTCAGCGGTGCGGCGTTGACGATGAAGGATTTTCCCAATG
TGCACGTTTACGCATTGAAACCGGCTTCCCTTCCGGAAGATTATTGGCTC
AAGCCCGTTTATGCGCTGTTCCGTCAGGCCGACATTCCGATTTTGGCATT
TGACGATAAAAATCAATCGCATGGTAAATCAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy