Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0876 IGR0877 IGR0878 IGR0880 IGR0879 IGR0874.2 IGR0875 IGR0874.1 NG1077 ydfG, - NG1079 lst, - NG1081 yciA, - NG1078 cyc, - NG1080 opaH,opaK, - NG1076 NG1075 idh, - NG1082 NG1077 ydfG, - NG1079 lst, - NG1081 yciA, - NG1078 cyc, - NG1080 opaH,opaK, - NG1076 NG1075 idh, - NG1082 Type: tandem, Name:  - 46 Type: tandem, Name:  - 47 Type: tandem, Name:  - 48 NG1077 ydfG, - NG1079 lst, - NG1081 yciA, - NG1078 cyc, - NG1080 opaH,opaK, - NG1076 NG1075 idh, - NG1082
* Calculated from Protein Sequence

Gene ID: NG1079

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ydfG  

Definition:
oxidoreductase, short-chain dehydrogenase/reductase family protein

Gene Start:
1038110

Gene Stop:
1037292

Gene Length:
819

Molecular Weight*:
30111

pI*:
4.80

Net Charge*:
-6.93

EC:
1.1.1.-  

Functional Class:
Unassigned  

Pathway: pathway table
Ascorbate and aldarate metabolism
Bile acid biosynthesis
Butanoate metabolism
Fructose and mannose metabolism
Galactose metabolism
Glycerolipid metabolism
Glycine, serine and threonine metabolism
Lysine degradation
Nucleotide sugars metabolism
Phenylalanine metabolism
Tetrachloroethene degradation
Vitamin B6 metabolism

Comment:
Oklahoma ID: NGO.1079c

Blast Summary:  PSI-Blast Search
Residues 1-273 are 97% similar to a probable oxidoreductase from N. meningitidis group A strain Z2491 (11250519|)

Numerous hits in gapped BLAST to oxidoreductase / short chain dehydrogenase sequences,e.g.residues 1-245 are 55% similar to a putative oxidoreductase from Escherichia coli O157:H7 (12515117). Residues 3-245 are 51% similar to a probable short-chain dehydrogenase from Pseudomonas aeruginosa strain PAO1 (11351873).

COGS Summary:  COGS Search
BeTs to 6 clades of COG0300
COG name: Short-chain dehydrogenases of various substrate specificities
Functional Class:  R
The phylogenetic pattern of COG0300 is ----y--ceBRhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002198 (Short-chain dehydrogenase/reductase (SDR) superfamily) with a combined E-value of 6.2e-09.
    IPB002198    127-162


ProDom Summary:  Protein Domain Search
Residues 209-247 are 61% similar to a (OXIDOREDUCTASE PROTEIN SHORT CHAIN ALCOHOL DEHYDROGENASE) protein domain (PD006579) which is seen in YDFG_HAEIN.

Residues 3-202 are 54% similar to a (PROTEIN OXIDOREDUCTASE DEHYDROGENASE REDUCTASE NAD NADP) protein domain (PD000038) which is seen in YDFG_ECOLI.



Paralogs:  Local Blast Search


NG1079 is paralogously related to NG2163 (3-oxoacyl-[acyl-carrier protein] reductase) (3e-17), NG0832 (oxidoreductase, short chain dehydrogenase/reductase family protein) (3e-07) and NG1351 (3-oxoacyl (carrier protein) reductase (ACP)) (5e-07).


Pfam Summary:  Pfam Search
Residues 3 to 244 (E-value = 8.8e-62) place NG1079 in the adh_short family which is described as short chain dehydrogenase (PF00106)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
41

PDB Hit:
pdb|1I01|1I01-A CRYSTAL STRUCTURE OF BETA-KETOACYL [ACYL CARRIER 97.1 3e-21
pdb|1HDC|1HDC-A 3-ALPHA, 20-BETA-HYDROXYSTEROID DEHYDROGENASE 91.7 1e-19
pdb|1GCO|1GCO-A CRYSTAL STRUCTURE OF GLUCOSE DEHYDROGENASE 78.0 2e-15
pdb|1NFF|1NFF-A CRYS

Gene Protein Sequence:
MAVLITGASAGFGEAMCRTFVGAGYRVIGAARRADRLQALADELGALFYP
LEMDVSCRESVENALNGIPDEFSDIDCLINNAGLALGLDTADKADFEDWE
TMIQTNVLGLTFLTRKILPQMVERGGGYVMNLGSIAGNYAYAGSNVYGAT
KAFVRQFSLNLRAELADKNIRVTNIEPGLCGNTEFSNVRFKGDNERVAGV
YEGVEFIRPEDIAETALWLYRRPAHMNVNTIEIMPVAQTFAGMKVIKTAV
PEVREDFEKQSMSLFSRIRSWFK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGTTTTAATTACCGGTGCTTCGGCAGGCTTCGGCGAAGCGATGTG
CCGCACGTTTGTCGGGGCGGGATACCGCGTTATCGGTGCGGCGCGCCGTG
CGGACAGGCTTCAGGCTTTGGCGGATGAATTGGGTGCTTTGTTTTACCCT
TTGGAAATGGACGTGTCGTGCCGCGAGTCGGTGGAAAACGCCTTGAACGG
CATCCCCGATGAATTTTCCGACATCGACTGCCTCATCAACAATGCCGGGC
TGGCTTTGGGTTTGGACACGGCGGACAAGGCGGATTTTGAAGATTGGGAA
ACAATGATTCAAACCAATGTTTTGGGTTTGACGTTCCTGACGCGCAAGAT
TTTGCCGCAAATGGTGGAACGCGGCGGCGGTTATGTGATGAATTTGGGTT
CGATTGCAGGCAATTATGCTTATGCCGGCAGCAACGTTTACGGGGCGACC
AAGGCGTTTGTGCGCCAGTTTAGCCTGAATTTGCGCGCAGAGCTGGCGGA
TAAGAACATCCGCGTTACCAATATCGAGCCGGGTTTGTGCGGCAATACGG
AGTTTTCCAACGTGCGCTTCAAAGGCGATAACGAGAGGGTGGCGGGCGTG
TATGAGGGTGTGGAATTTATCCGCCCCGAAGATATTGCGGAAACCGCATT
GTGGCTGTACCGCCGGCCGGCGCATATGAATGTGAACACGATTGAAATTA
TGCCTGTGGCGCAGACTTTTGCAGGAATGAAGGTCATAAAAACAGCCGTG
CCCGAAGTGCGGGAAGACTTTGAAAAACAGAGTATGTCGCTGTTTTCCCG
CATCAGGTCTTGGTTCAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy