Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0876 IGR0877 IGR0878 IGR0879 IGR0874.2 IGR0875 IGR0874.1 NG1077 ydfG, - NG1079 lst, - NG1081 yciA, - NG1078 cyc, - NG1080 NG1074 opaH,opaK, - NG1076 NG1075 idh, - NG1082 NG1077 ydfG, - NG1079 lst, - NG1081 yciA, - NG1078 cyc, - NG1080 NG1074 opaH,opaK, - NG1076 NG1075 idh, - NG1082 Type: tandem, Name:  - 48 Type: tandem, Name:  - 45 Type: tandem, Name:  - 46 Type: tandem, Name:  - 47 NG1077 ydfG, - NG1079 lst, - NG1081 yciA, - NG1078 cyc, - NG1080 NG1074 opaH,opaK, - NG1076 NG1075 idh, - NG1082
* Calculated from Protein Sequence

Gene ID: NG1078

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yciA  

Definition:
acyl-CoA hydrolase (P14 protein)

Gene Start:
1036792

Gene Stop:
1037235

Gene Length:
444

Molecular Weight*:
16320

pI*:
6.70

Net Charge*:
-0.48

EC:
3.1.2.2  

Functional Class:
Unassigned  

Pathway: pathway table

Secondary Evidence:
Postle,K. and Good,R.F.
A bidirectional rho-independent transcription terminator between the E. coli tonB gene and an opposing gene.
Cell 41 (2): 577-585 (1985)
[Medline: 85176981].

Comment:
From Medline (85176981): An Escherichia coli gene, designated P14, is adjacent to and in the opposite orientation to the tonB gene. The 36 base pair intercistronic region between tonB and P14 contains a novel rho-independent transcription terminator that functions bidirectionally, both in vivo and in vitro, to terminate tonB and P14 transcription. Transcription of tonB and P14 terminates at symmetrically equivalent nucleotides, such that the 3' ends of tonB and P14 transcripts are complementary. The terminator is more efficient in the tonB direction (95%) than in the P14 direction (70%). This gene arrangement may have regulatory consequences for the expression of tonB.

Oklahoma ID: NGO.1078

Blast Summary:  PSI-Blast Search
NG1078 is orthologous to AE002444, N. meningitidis MC58 acyl CoA thioester hydrolase family protein: residues 1-148 have 97% similarity to residues 1-148 in NG1078.

NG1078 also has significant (P-value < 1e-40) similarity to several other acyl-CoA thioester hydrolase proteins in several other organisms; e.g. residues 11-136 are 60% similar to 140426 of Escherichia coli.


COGS Summary:  COGS Search
BeTs to 4 clades of COG1607
COG name: Acyl-CoA hydrolase
Functional Class:  I
The phylogenetic pattern of COG1607 is --------eb-huj----in-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002590 (Cytosolic long-chain acyl-CoA thioester hydrolase) with a combined E-value of 3.6e-51.
    IPB002590A    23-53
    IPB002590B    55-102
    IPB002590C    114-130


ProDom Summary:  Protein Domain Search
Residues 12-136 are 64% similar to a (PROTEIN HYDROLASE ACYL-COA THIOESTER CYTOSOLIC ACYL) protein domain (PD003302) which is seen in YCIA_HAEIN.



Paralogs:  Local Blast Search


NG1078 is paralogously related to NG1055 (acyl CoA thioester hydrolase family protein) (2e-09).


Pfam Summary:  Pfam Search
Residues 29 to 107 (E-value = 3e-19) place NG1078 in the 4HBT family which is described as Thioesterase superfamily (PF03061)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MQHEEGNRQRPQGELLLRTVAMPRDTNPNQDIFGGWIMSQMDLGGGILAA
EIARGRIVTVAVQEMNFIRPVKVGNVVCCYGHCVRVGNTSLQLKVEVWVK
TLMNDCVTEDRHLVTEAVFTYVAIDAEGNPRPIPKEGNPKLSGLLPTP

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGCACGAAGAAGGCAACCGCCAACGCCCTCAAGGCGAACTTCTCCT
GCGTACCGTCGCTATGCCGCGCGATACCAATCCCAACCAAGACATTTTCG
GCGGCTGGATTATGTCGCAAATGGATTTGGGCGGCGGCATATTGGCGGCG
GAAATCGCGCGGGGGCGCATCGTTACCGTCGCCGTTCAGGAAATGAACTT
CATCCGCCCGGTCAAGGTCGGCAACGTCGTCTGCTGCTACGGGCATTGCG
TCCGCGTGGGCAATACTTCCCTCCAGCTTAAAGTCGAAGTCTGGGTGAAA
ACTTTGATGAACGATTGCGTTACCGAAGACCGCCATCTCGTAACCGAGGC
GGTGTTCACTTATGTCGCCATCGATGCGGAAGGCAATCCGCGCCCGATTC
CGAAAGAAGGCAACCCCAAATTGTCGGGCTTATTGCCCACCCCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy