Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0868 IGR0865 IGR0863 IGR0864 IGR0866 IGR0867 NG1063 fimB, - NG1060 nlpD, - NG1056 gabD,ssdH, - NG1061 NG1059 tpn, - NG1066 NG1062 cstA, - NG1064 NG1063 fimB, - NG1060 nlpD, - NG1056 gabD,ssdH, - NG1061 NG1059 tpn, - NG1066 NG1062 cstA, - NG1064 Type: inverse, Name:  - 177 NG1063 fimB, - NG1060 nlpD, - NG1056 gabD,ssdH, - NG1061 NG1059 surE, - NG1057 surE, - NG1057 NG1062 cstA, - NG1064 NG1065 tpn, - NG1066 NG1065
* Calculated from Protein Sequence

Gene ID: NG1061

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gabD  ssdH  

Definition:
succinate semialdehyde dehydrogenase

Gene Start:
1021611

Gene Stop:
1020181

Gene Length:
1431

Molecular Weight*:
50999

pI*:
5.50

Net Charge*:
-4.57

EC:
1.2.1.16  

Functional Class:
Central intermediary metabolism; Other  

Pathway: pathway table
Butanoate metabolism
Glutamate metabolism
Tyrosine metabolism

Secondary Evidence:
Schneider BL, Ruback S, Kiupakis AK, Kasbarian H, Pybus C, Reitzer L.
The Escherichia coli gabDTPC operon: specific gamma-aminobutyrate catabolism and nonspecific induction.
J Bacteriol. 2002 Dec;184(24):6976-86.
PMID: 12446648

Niegemann,E., Schulz,A. and Bartsch,K.
Molecular organization of the Escherichia coli gab cluster: nucleotide sequence of the structural genes gabD and gabP andexpression of the GABA permease gene.
Arch. Microbiol. 160 (6): 454-460 (1993) [
Medline: 94127927].


Sohling B, Gottschalk G.
Molecular analysis of the anaerobic succinate degradation pathway in Clostridium kluyveri.
J Bacteriol. 1996 Feb;178(3):871-80.
PMID: 8550525

Comment:
From GenBANK (gi:120777): GabD of E. coli catalyzes the reaction: succinate semialdehyde + NADP(+) + H2O = succinate + NADPH, involved in the 4-aminobutyrate (GABA) degradation pathway. GabD belongs to the aldehyde dehydrogenases family.

Oklahoma ID: NGO.1061c

Blast Summary:  PSI-Blast Search
NG1061 is orthologous to AL162756, N. meningitidis Z2491 succinate semialdehyde dehydrogenase: residues 1-477 have 96% similarity to residues 1-477 in NG1061.

NG1061 also has very strong (P-value < 1e-100) similarity to succinate semialdehyde dehydrogenase proteins in several other organisms; e.g. residues 20-474 are 60% similar to 120777 of Escherichia coli.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1012
COG name: NAD-dependent aldehyde dehydrogenases
Functional Class:  C
The phylogenetic pattern of COG1012 is -mt-Yq-CEBR-uj-------
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search
***** IPB002086 (Aldehyde dehydrogenase family) with a combined E-value of 4.4e-92.
    IPB002086A    140-153
    IPB002086B    194-211
    IPB002086C    220-240
    IPB002086D    254-297
    IPB002086E    361-414
    IPB002086F    435-459


ProDom Summary:  Protein Domain Search
Residues 145-218 are 67% similar to a (DEHYDROGENASE OXIDOREDUCTASE ALDEHYDE NAD PROTEIN ALDH) protein domain (PD000219) which is seen in P94428_BACSU.

Residues 385-474 are 68% similar to a (DEHYDROGENASE OXIDOREDUCTASE ALDEHYDE NAD PROTEIN ALDH) protein domain (PD000187) which is seen in GABD_ECOLI.

Residues 65-142 are 57% similar to a (DEHYDROGENASE OXIDOREDUCTASE ALDEHYDE NAD PROTEIN) protein domain (PD000314) which is seen in GABD_ECOLI.

Residues 323-382 are 65% similar to a (DEHYDROGENASE OXIDOREDUCTASE ALDEHYDE NAD PROTEIN ALDH) protein domain (PD000263) which is seen in SSDH_RAT.

Residues 220-320 are 72% similar to a (DEHYDROGENASE OXIDOREDUCTASE ALDEHYDE NAD PROTEIN ALDH) protein domain (PD000218) which is seen in GABD_ECOLI.



Paralogs:  Local Blast Search


NG1061 is paralogously related to NG2114 (aldehyde dehydrogenase) (4e-76), NG0665 (aldehyde dehydrogenase) (9e-65) and NG1554 (proline dehydrogenase) (4e-35).


Pfam Summary:  Pfam Search
Residues 15 to 476 (E-value = 4.1e-193) place NG1061 in the Aldedh family which is described as Aldehyde dehydrogenase family (PF00171)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
274

PDB Hit:
pdb|1A4S|1A4S-A BETAINE ALDEHYDE DEHYDROGENASE FROM COD LIVER 276.0 7e-75
pdb|1BI9|1BI9-A RETINAL DEHYDROGENASE TYPE TWO WITH NAD BOUND 272.0 1e-73
pdb|1BXS|1BXS-A SHEEP LIVER CLASS 1 ALDEHYDE DEHYDROGENASE WITH 264.0 3e-71
pdb|1CW3|1CW3-A HUMA

Gene Protein Sequence:
MNEYSQLIKHPDISLSPISDGIGVGNPATGEILAYVRNTGSDKLKNLIQK
AAAAQKLWAAKTALERADILWRWYFLVKENKEALARLMTMEQGKSLTEAR
GEIDYAASFVRWFAEEARRIDGDVLTSVKASQKLVVLKQPVGVTAAITPW
NFPSAMIARKAAPALAVGCAMIVKPASLTPLSAYALAVLAYEAGVPQDLL
PVVSGRASEISHEFATNPTVRKISFTGSTEVGAKIFAGSAADIKKLSLEL
GGNAPFIVFDDADLDKAVEGALASKFRNSGQTCVCTNRVYVQSGIYDVFC
RKLSEKAAALKLGDGLDEGVNQGPLIEEKAVEKVEQHIADALSKGAVCLT
GGKRSALGGTFFEPTVLSGVTAQMAVAREETFGPLCPVFRFETEAEVIEA
ANNTEYGLAAYLFTSDTARQWRVGEVLEYGMVGINTGLISNEAAPFGGVK
RSGLGREGSKYGADEYLELKYLCIDAG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGAATATTCCCAATTAATCAAGCATCCCGATATTTCCCTTTCCCC
GATTTCAGACGGCATCGGGGTCGGCAATCCGGCGACGGGCGAAATTTTGG
CGTATGTCCGCAACACGGGTTCGGACAAGCTGAAAAACCTGATTCAAAAG
GCGGCGGCAGCGCAAAAATTATGGGCGGCGAAAACCGCCTTGGAACGCGC
CGACATATTGTGGCGTTGGTATTTTTTAGTTAAAGAAAACAAAGAAGCAC
TGGCGCGTCTCATGACGATGGAGCAGGGCAAAAGCCTGACCGAGGCGCGC
GGCGAAATCGATTATGCGGCTTCGTTTGTGCGCTGGTTTGCCGAAGAGGC
GCGGCGGATTGACGGCGATGTGCTGACGAGTGTGAAAGCGTCGCAAAAAC
TGGTTGTGTTGAAACAGCCCGTCGGCGTTACCGCTGCGATTACGCCGTGG
AATTTCCCGTCCGCGATGATTGCGCGCAAGGCCGCGCCTGCTTTGGCGGT
GGGCTGCGCGATGATAGTCAAACCTGCATCGCTCACGCCTTTGAGTGCGT
ATGCGTTGGCTGTACTGGCCTACGAAGCGGGCGTGCCGCAGGATTTGCTT
CCCGTCGTCAGCGGCCGCGCTTCGGAAATCAGCCATGAATTTGCCACGAA
CCCGACCGTGCGCAAAATCAGCTTCACCGGCTCGACCGAAGTCGGCGCGA
AAATTTTTGCCGGCAGCGCGGCGGACATTAAAAAACTCAGTTTGGAACTG
GGCGGCAACGCGCCGTTTATCGTGTTTGACGATGCCGATTTGGACAAAGC
CGTCGAAGGCGCGCTGGCGAGCAAGTTCCGCAACAGCGGTCAGACCTGCG
TCTGCACCAACCGCGTTTACGTCCAATCGGGCATTTACGACGTATTTTGC
CGCAAATTGAGTGAAAAGGCAGCCGCGCTCAAATTGGGCGACGGCTTGGA
CGAAGGTGTGAACCAAGGACCGCTGATTGAGGAAAAAGCGGTAGAAAAAG
TCGAACAGCACATCGCCGACGCACTCTCCAAAGGCGCGGTCTGTCTGACC
GGCGGCAAACGCAGCGCGTTGGGCGGAACGTTTTTTGAGCCGACTGTCTT
AAGCGGCGTTACGGCGCAAATGGCGGTAGCTCGCGAGGAAACCTTCGGGC
CTTTGTGTCCGGTGTTCCGTTTTGAAACCGAAGCCGAAGTCATCGAGGCT
GCGAACAATACGGAATACGGTTTGGCAGCTTACCTTTTCACCTCCGACAC
CGCCCGTCAATGGCGCGTCGGCGAAGTCTTGGAATACGGCATGGTCGGCA
TCAATACGGGCTTAATCAGTAATGAAGCGGCACCGTTCGGCGGGGTGAAA
CGCAGCGGTTTGGGACGTGAAGGCAGCAAATACGGTGCGGACGAATATCT
AGAATTGAAATATTTGTGCATTGATGCCGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy