Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0858 IGR0859 IGR0860 IGR0855 IGR0861 IGR0856 IGR0863 IGR0864 IGR0862 IGR0857 dmpI, - NG1048 fimB, - NG1060 nlpD, - NG1056 aat, - NG1047 NG1059 NG1054 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 dmpI, - NG1048 fimB, - NG1060 nlpD, - NG1056 aat, - NG1047 NG1059 NG1054 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 fimB, - NG1060 nlpD, - NG1056 aat, - NG1047 NG1059 surE, - NG1057 surE, - NG1057 dmpI, - NG1048 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 NG1054
* Calculated from Protein Sequence

Gene ID: NG1055

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
vdlD  

Definition:
acyl CoA thioester hydrolase family protein

Gene Start:
1014597

Gene Stop:
1015076

Gene Length:
480

Molecular Weight*:
17876

pI*:
7.70

Net Charge*:
1.67

EC:
3.1.2.2  

Functional Class:
Unassigned  

Pathway: pathway table

Secondary Evidence:
Cao,P. and Cover,T.L.
High-level genetic diversity in the vapD chromosomal region of Helicobacter pylori.
J. Bacteriol. 179 (9): 2852-2856 (1997)
[Medline: 97284485].

Comment:
Oklahoma ID: NGO.1055

Blast Summary:  PSI-Blast Search
NG1055 is orthologous to AE002497, N. meningitidis MC58 acyl CoA thioester hydrolase family protein: residues 1-160 have 98% similarity to residues 1-160 in NG1055.

NG1055 also has many moderately significant hits to acyl CoA thioester hydrolase family proteins in several other organisms; e.g. residues 8-148 are 38% similar to 10174922 of Bacillus halodurans.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1607
COG name: Acyl-CoA hydrolase
Functional Class:  I
The phylogenetic pattern of COG1607 is --------eb-huj----in-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002590 (Cytosolic long-chain acyl-CoA thioester hydrolase) with a combined E-value of 9e-49.
    IPB002590A    20-50
    IPB002590B    52-99
    IPB002590C    107-123


ProDom Summary:  Protein Domain Search
Residues 11-126 are 60% similar to a (PROTEIN HYDROLASE ACYL-COA THIOESTER CYTOSOLIC ACYL) protein domain (PD003302) which is seen in VDLD_HELPY.



Paralogs:  Local Blast Search


NG1055 is paralogously related to NG1078 (acyl-CoA hydrolase (P14 protein)) (2e-09).


Pfam Summary:  Pfam Search
Residues 26 to 104 (E-value = 1.8e-17) place NG1055 in the 4HBT family which is described as Thioesterase superfamily (PF03061)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MTQQRQLPSHELIMSELMMPDTANFSGNVHGGELLLLLDQVAYSCASRYS
GNYCVTLSVDKVLFKEPIHIGDLVTFYAAVNYTGRTSMEIGIRVEAQNIR
TGEIRHTNSCYFTMVAVKDGKPVPVPPLEILTDRQRCRYEKAKKRREISL
QASGDVSCGC

Gene Nucleotide Sequence:  Sequence Viewer
ATGACACAACAACGCCAACTGCCTTCCCACGAACTCATTATGTCCGAACT
GATGATGCCGGACACCGCCAATTTCAGCGGCAACGTACACGGCGGCGAAC
TCCTGCTCCTGCTCGACCAGGTTGCCTATTCCTGCGCCAGCCGTTACAGC
GGCAATTATTGCGTTACCCTTTCGGTTGACAAAGTCCTGTTTAAAGAACC
CATCCACATCGGCGATTTGGTTACCTTTTACGCCGCTGTCAACTACACGG
GACGCACCTCGATGGAAATCGGCATCCGTGTCGAAGCACAAAACATCCGC
ACCGGCGAAATCCGCCATACCAACAGCTGCTACTTCACGATGGTTGCGGT
CAAAGACGGCAAACCCGTCCCCGTCCCTCCGCTGGAAATCCTGACCGACC
GCCAACGCTGCCGCTACGAAAAAGCCAAAAAACGCAGAGAAATCAGCCTC
CAAGCCTCCGGAGACGTGTCCTGCGGCTGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy