Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0858 IGR0859 IGR0860 IGR0855 IGR0861 IGR0856 IGR0863 IGR0864 IGR0862 IGR0857 dmpI, - NG1048 fimB, - NG1060 nlpD, - NG1056 aat, - NG1047 NG1059 NG1054 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 dmpI, - NG1048 fimB, - NG1060 nlpD, - NG1056 aat, - NG1047 NG1059 NG1054 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 dmpI, - NG1048 fimB, - NG1060 nlpD, - NG1056 aat, - NG1047 NG1059 surE, - NG1057 surE, - NG1057 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 NG1054
* Calculated from Protein Sequence

Gene ID: NG1054

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Neisseria-specific protein, uncharacterized

Gene Start:
1014283

Gene Stop:
1014441

Gene Length:
159

Molecular Weight*:
6119

pI*:
9.40

Net Charge*:
1.46

EC:
 

Functional Class:
Neisseria-specific protein  
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.1054

Blast Summary:  PSI-Blast Search
NG1054 is orthologous to AL162756, N. meningitidis hypothetical protein: residues 19-72 have 94% similarity to residues 1-53.

No hits to any other organism in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1054 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
31  
47

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSEQPEKHHASPIEDERKNPVYRMGRAVAGFMLAVWAGVLALVFFLVFRF
WLS

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGAACAACCCGAAAAACACCACGCCTCCCCCATCGAAGACGAACG
CAAAAACCCGGTTTACCGTATGGGACGGGCGGTTGCCGGATTCATGCTCG
CCGTTTGGGCGGGCGTGCTGGCACTCGTGTTTTTCTTGGTTTTCCGTTTT
TGGCTTTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy