Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0858 IGR0859 IGR0860 IGR0854 IGR0855 IGR0861 IGR0856 IGR0863 IGR0862 IGR0857 dmpI, - NG1048 nlpD, - NG1056 aat, - NG1047 NG1059 NG1054 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 clpB, - NG1046 dmpI, - NG1048 nlpD, - NG1056 aat, - NG1047 NG1059 NG1054 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 clpB, - NG1046 dmpI, - NG1048 nlpD, - NG1056 aat, - NG1047 NG1059 surE, - NG1057 surE, - NG1057 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 clpB, - NG1046 NG1054
* Calculated from Protein Sequence

Gene ID: NG1052

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gph  

Definition:
phosphoglycolate phosphatase

Gene Start:
1012965

Gene Stop:
1013672

Gene Length:
708

Molecular Weight*:
25640

pI*:
4.50

Net Charge*:
-13.12

EC:
3.1.3.18  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Glyoxylate and dicarboxylate metabolism

Secondary Evidence:
Lyngstadaas,A., Lobner-Olesen,A. and Boye,E. Characterization of three genes in the dam-containing operon of Escherichia coli. Mol. Gen. Genet. 247 (5): 546-554 (1995) [Medline: 9532705].

Comment:
From GenBANK (gi:418445): Catalytic activity: 2-phosphoglycolate + H2O = glycolate + orthophosphate.

Oklahoma ID: NGO.1052

Blast Summary:  PSI-Blast Search
NG1052 is orthologous to AL162756, N. meningitidis Z2491 putative phosphatase: residues 1-235 have 96% similarity to residues 1-235 in NG1052.
NG1052 also has strong (P-value < 1e-20) similarity to phosphatase proteins in several other organisms, e.g. residues 6-209 are 40% similar to GPH_ECOLI (418445).


COGS Summary:  COGS Search
BeTs to 8 clades of COG0546
COG name: Predicted phosphatases
Functional Class:  R
The phylogenetic pattern of COG0546 is a-TkyQ-CEBRhuj--oL---
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** PR00413 (Haloacid dehalogenase/epoxide hydrolase family signature) with a combined E-value of 2.3e-08.
    PR00413A    8-19
    PR00413D    108-121
    PR00413E    139-155


ProDom Summary:  Protein Domain Search
Residues 162-209 are 64% similar to a (PROTEIN PHOSPHATASE LONG PHOSPHOGLYCOLATE) protein domain (PD000816) which is seen in GPH_ECOLI.

Residues 105-211 are 29% similar to a (HYPOTHETICAL 14.3 KD PROTEIN) protein domain (PD081712) which is seen in YM33_MYCTU.

Residues 11-146 are 38% similar to a (PHOSPHOGLYCOLATE PHOSPHATASE PGP) protein domain (PD003468) which is seen in GPH_AQUAE.



Paralogs:  Local Blast Search


NG1052 is paralogously related to NG0203 (probable phosphoglycolate phosphatase) (6e-18) and NG0073 (phosphatase/hydrolase (possible phosphoglycolate phosphatase)) (4e-11).


Pfam Summary:  Pfam Search
Residues 8 to 198 (E-value = 5.2e-43) place NG1052 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
91  
159
transmembrane  
103  
119
transmembrane  
182  
198

PDB Hit:
pdb|1LVH|1LVH-A THE STRUCTURE OF PHOSPHORYLATED 202.0 7e-53

Gene Protein Sequence:
MNAAIEHVQAVAFDLDGTLCDSVPDLAAAAEAMLEQLGMKPLPAKVVESY
VGDGIGKLVHRVLTNDRDREADSELWEKGFVSYMKYYRDHLSVFTRPYPE
TEAGLALLKSLGIPLVIITNKNEILAAELLKQLGLADYFSLILGGDSLPE
KKPSPLPLRHAAEVLGIDAANMLMVGDSRNDIIAAKAAGCLSVGVTFGYG
DMTLLSQDDTTRPDRIIGALPEIYENLQPQKNKDEE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGCAGCCATCGAACACGTCCAAGCCGTCGCCTTCGATTTGGACGG
CACACTGTGCGATTCCGTCCCCGACCTTGCCGCCGCCGCAGAAGCGATGT
TGGAACAACTCGGTATGAAACCGCTGCCCGCCAAAGTGGTCGAAAGCTAC
GTCGGCGACGGCATCGGCAAACTGGTTCACCGCGTCCTCACCAACGACCG
CGACCGCGAAGCCGATTCCGAACTGTGGGAAAAAGGTTTCGTGTCCTATA
TGAAATACTACCGCGACCATTTGAGCGTCTTCACCCGCCCCTATCCCGAA
ACCGAAGCCGGGCTGGCATTGCTCAAATCCTTGGGCATTCCGCTGGTAAT
CATTACCAACAAAAACGAAATCCTTGCCGCCGAGCTTCTAAAACAACTGG
GACTCGCCGACTACTTCAGCCTGATACTCGGCGGAGACAGCCTGCCCGAA
AAAAAACCCAGCCCGCTGCCGCTGCGGCACGCCGCCGAAGTTTTGGGTAT
CGATGCCGCCAATATGCTTATGGTCGGCGACTCGCGCAACGACATCATCG
CCGCCAAAGCCGCCGGCTGCCTGAGTGTCGGCGTTACCTTCGGTTACGGC
GATATGACGCTGCTCTCGCAAGACGATACGACCCGCCCCGACCGGATTAT
CGGCGCGCTGCCCGAAATTTACGAAAACCTGCAACCGCAGAAAAACAAAG
ACGAAGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy