Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0858 IGR0859 IGR0860 IGR0854 IGR0855 IGR0861 IGR0856 IGR0853 IGR0862 IGR0857 dmpI, - NG1048 syw, - NG1045 aat, - NG1047 NG1054 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 clpB, - NG1046 dmpI, - NG1048 syw, - NG1045 aat, - NG1047 NG1054 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 clpB, - NG1046 dmpI, - NG1048 syw, - NG1045 aat, - NG1047 NG1051 recX,oraA, - NG1053 vdlD, - NG1055 gph, - NG1052 NG1049 clpB, - NG1046 NG1054
* Calculated from Protein Sequence

Gene ID: NG1048

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dmpI  

Definition:
probable 4-oxalocrotonate tautomerase (dmpI)

Gene Start:
1010293

Gene Stop:
1010087

Gene Length:
207

Molecular Weight*:
7403

pI*:
5.20

Net Charge*:
-1.01

EC:
5.3.2.-  

Functional Class:
Other categories; Other  

Pathway: pathway table

Secondary Evidence:
Brik A, Dawson PE, Keinan E.
The product of the natural reaction catalyzed by 4-oxalocrotonate tautomerase becomes an affinity label of its mutant.
Bioorg Med Chem. 2002 Dec;10(12):3891-7.
PMID: 12413840

Soares TA, Lins RD, Straatsma TP, Briggs JM.
Internal dynamics and ionization states of the macrophage migration inhibitory factor: comparison between wild-type and mutant forms.
Biopolymers. 2002 Nov 15;65(4):313-23.
PMID: 12382291

Almrud JJ, Kern AD, Wang SC, Czerwinski RM, Johnson WH Jr, Murzin AG, Hackert ML, Whitman CP.
The crystal structure of YdcE, a 4-oxalocrotonate tautomerase homologue from Escherichia coli, confirms the structural basis for
oligomer diversity.
Biochemistry. 2002 Oct 8;41(40):12010-24.
PMID: 12356301

Brik A, D'Souza LJ, Keinan E, Grynszpan F, Dawson PE.
Mutants of 4-oxalocrotonate tautomerase catalyze the decarboxylation of oxaloacetate through an imine mechanism.
Chembiochem. 2002 Sep 2;3(9):845-51.
PMID: 12210985

Comment:
Oklahoma ID: NGO.1048c

Blast Summary:  PSI-Blast Search
NG1048 is orthologous to AL162756, N. meningitidis Z2491 putative tautomerase: residues 1-69 have 97% similarity to residues 1-69 in NG1048.

NG1048 also has weak similarity to 4-oxalocrotonate tautomerase in E. chrysanthemi (1e-15), C. jejuni (9e-15), C. crescentus (6e-11) and H. pylori (2e-10).


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB001603 (Tautomerase enzyme) with a combined E-value of 2.8e-16.
    IPB001603    15-56
    IPB001603    5-46


ProDom Summary:  Protein Domain Search
Residues 1-60 are 46% similar to a (4-OXALOCROTONATE ISOMERASE PROTEIN) protein domain (PD019232) which is seen in YKDK_ERWCH.



Paralogs:  Local Blast Search


NG1048 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 64 (E-value = 9.6e-28) place NG1048 in the Tautomerase family which is described as Tautomerase enzyme (PF01361)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPYVNIKVTGGKEAPTAAQKAELIGGVIELLARVLGKNPETTVVVIDEVD
TDNWDIGGKSVSERRKEGR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTTATGTCAATATTAAAGTAACCGGCGGCAAGGAAGCACCGACTGC
CGCGCAAAAAGCGGAACTGATCGGCGGCGTAATCGAATTGCTGGCACGCG
TGCTGGGTAAAAATCCCGAAACAACGGTTGTCGTGATTGACGAAGTGGAT
ACCGATAACTGGGATATAGGCGGCAAAAGCGTCAGCGAACGGCGCAAAGA
GGGCAGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy