Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0858 IGR0859 IGR0860 IGR0854 IGR0852 IGR0855 IGR0856 IGR0853 IGR0857 dmpI, - NG1048 NG1044 syw, - NG1045 aat, - NG1047 NG1054 NG1051 recX,oraA, - NG1053 gph, - NG1052 NG1049 clpB, - NG1046 dmpI, - NG1048 NG1044 syw, - NG1045 aat, - NG1047 NG1054 NG1051 recX,oraA, - NG1053 gph, - NG1052 NG1049 clpB, - NG1046 Type: tandem, Name:  - 44 dmpI, - NG1048 NG1044 syw, - NG1045 aat, - NG1047 NG1051 recX,oraA, - NG1053 gph, - NG1052 NG1049 clpB, - NG1046 NG1054
* Calculated from Protein Sequence

Gene ID: NG1047

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aat  

Definition:
aminotransferase

Gene Start:
1009995

Gene Stop:
1008784

Gene Length:
1212

Molecular Weight*:
45414

pI*:
7.00

Net Charge*:
0.00

EC:
2.6.1.-  

Functional Class:
Unassigned  

Pathway: pathway table
Aminophosphonate metabolism
Caprolactam degradation
Histidine metabolism
Lysine biosynthesis

Comment:
For other 'aat'genes see NG1778.

From GenBANK (gi:): In E. coli, this protein requires a cofactor for activity, pyridoxal phosphate. It belongs to the pyridoxal-phosphate-dependent class I of aminotransferases.

For other aminotransferases, see NG0082 (avtA), NG0308 (bioA), NG0460, NG0646 (argD), NG2045 (glmS), NG1241 (hisC), NG1283 (serC), NG1329 (tyrB), NG1452 (aspC).

Oklahoma ID: NGO.1047c

Blast Summary:  PSI-Blast Search
NG1047 is orthologous to AE002497, N. meningitidis MC58 class I aminotransferase: residues 1-404 have similarity to residues 1-404 in NG1047.

NG1047 also has very strong similarity (P-value < 1e-100) to several other aminotransferase proteins; e.g. residues 1-404 are 79% similar to 12720257 of Pasteurella multocida.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0436
COG name: PLP-dependent aminotransferases
Functional Class:  E
The phylogenetic pattern of COG0436 is AMTKYQVCEBRhUJ---linx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001511 (Aminotransferases class-I) with a combined E-value of 2.4e-14.
    IPB001511A    68-78
    IPB001511B    172-186
    IPB001511C    237-250


ProDom Summary:  Protein Domain Search
Residues 46-324 are 64% similar to a (PYRIDOXAL PHOSPHATE AMINOTRANSFERASE TRANSFERASE PROTEIN) protein domain (PD000087) which is seen in O86587_STRCO.

Residues 4-44 are 90% similar to a (AMINOTRANSFERASE TRANSFERASE PROBABLE PYRIDOXAL) protein domain (PD021715) which is seen in YFBQ_HAEIN.

Residues 328-399 are 70% similar to a (AMINOTRANSFERASE TRANSFERASE PYRIDOXAL PHOSPHATE) protein domain (PD000894) which is seen in YFBQ_HAEIN.

Residues 260-327 are 86% similar to a (PROBABLE AMINOTRANSFERASE PROTEIN) protein domain (PD188985) which is seen in YFBQ_ECOLI.



Paralogs:  Local Blast Search


NG1047 is paralogously related to NG0460 (probable aminotransferase) (4e-15).


Pfam Summary:  Pfam Search
Residues 83 to 399 (E-value = 8.1e-41) place NG1047 in the Aminotran_1_2 family which is described as Aminotransferase class I and II (PF00155)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
182  
233

PDB Hit:
pdb|1GD9|1GD9-A CRYSTALL STRUCTURE OF PYROCOCCUS PROTEIN-A1 139.0 6e-34
pdb|1DJU|1DJU-A CRYSTAL STRUCTURE OF AROMATIC AMINOTRANSFERASE 139.0 8e-34
pdb|1BW0|1BW0-A CRYSTAL STRUCTURE OF TYROSINE AMINOTRANSFERASE 136.0 7e-33
pdb|1GC3|1GC3-A THER

Gene Protein Sequence:
MDKFPKSAKLDHVCYDIRGPVHKKALQLEEEGNKILKLNIGNPAPFGFEA
PDEILVDVIRNLPTSQGYCDSKGLYSARKAIVHYYQNKGLRDITVNDVYI
GNGVSELIAMSMQALLNDGDEILIPAPDYPLWTAAATLAGGTVRHYLCDE
ENGWFPNLADMEAKITSKTKAIVVINPNNPTGAVYSKEILLEIAELARKH
GLIIFADEIYDKILYDGAVHYHIAALAPDLLTVTFNGLSKAYRVAGFRQG
WMVLNGPKHHAKGYIEGLDMLSSMRLCANTPMQHAIQTALGGYQSINEFI
LPGGRLLEQRNRAWELVNQIPGVSCVKPMGAMYMFPKIDTEMYRIRDDMK
FVYDLLVREKVLLVQGTGFNWIKPDHFRIVTLPYVHQIEEAMGRLARFLQ
TYHQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAAATTTCCCAAGTCTGCAAAGCTCGACCACGTCTGCTACGACAT
ACGCGGGCCGGTTCACAAAAAAGCCCTTCAGTTGGAAGAGGAGGGCAACA
AAATCCTCAAGCTCAATATCGGCAACCCTGCGCCGTTCGGCTTTGAAGCA
CCTGATGAAATCTTAGTCGATGTCATCCGCAACCTGCCGACTTCGCAAGG
TTATTGCGATTCGAAGGGGTTGTATTCCGCACGCAAAGCCATTGTTCACT
ACTATCAGAACAAAGGTTTGCGCGATATTACGGTAAACGATGTCTATATC
GGCAACGGCGTGTCCGAGCTGATTGCGATGTCTATGCAGGCGTTGCTCAA
CGACGGCGACGAAATCCTGATTCCCGCGCCCGACTACCCTTTGTGGACGG
CGGCGGCAACGCTTGCGGGCGGTACGGTACGCCATTATCTGTGCGACGAA
GAAAACGGCTGGTTTCCCAACCTTGCCGATATGGAAGCCAAAATCACGTC
CAAAACCAAAGCCATCGTCGTCATCAACCCCAATAACCCGACAGGAGCGG
TGTACAGCAAGGAAATCCTGCTGGAAATTGCCGAACTGGCGCGCAAGCAT
GGTTTGATTATTTTCGCCGACGAGATTTACGACAAAATCCTTTATGATGG
CGCGGTTCACTACCACATCGCCGCGCTCGCCCCCGACCTTTTGACGGTAA
CGTTCAACGGTTTGTCCAAAGCCTACCGTGTAGCCGGGTTCCGCCAAGGC
TGGATGGTGCTAAACGGGCCGAAACATCACGCAAAAGGTTATATCGAGGG
TTTGGATATGCTCTCGTCCATGCGCTTGTGTGCCAATACGCCGATGCAGC
ACGCGATTCAGACGGCATTGGGCGGTTATCAGAGCATTAACGAATTCATC
TTGCCCGGCGGACGGCTTTTGGAACAGCGCAACAGAGCGTGGGAACTGGT
CAACCAGATTCCCGGCGTGTCCTGCGTCAAACCGATGGGCGCGATGTATA
TGTTCCCGAAAATCGATACCGAAATGTACCGCATCCGCGATGATATGAAA
TTCGTTTACGATTTGCTGGTGCGCGAAAAAGTCCTGCTGGTACAGGGAAC
GGGGTTTAATTGGATCAAACCCGACCATTTCCGCATTGTTACGCTGCCTT
ACGTCCATCAGATTGAAGAGGCGATGGGCAGGTTGGCAAGATTCCTGCAA
ACCTACCATCAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy