Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0854 IGR0852 IGR0855 IGR0850 IGR0849 IGR0856 IGR0853 IGR0851 IGR0848 dmpI, - NG1048 NG1043 NG1044 syw, - NG1045 aat, - NG1047 NG1042 NG1040 ppx, - NG1041 clpB, - NG1046 dmpI, - NG1048 NG1043 NG1044 syw, - NG1045 aat, - NG1047 NG1042 NG1040 ppx, - NG1041 clpB, - NG1046 Type: tandem, Name:  - 43 Type: tandem, Name:  - 44 dmpI, - NG1048 NG1043 NG1044 syw, - NG1045 aat, - NG1047 NG1042 NG1040 ppx, - NG1041 clpB, - NG1046
* Calculated from Protein Sequence

Gene ID: NG1045

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
syw  

Definition:
tryptophanyl-tRNA synthetase/ligase

Gene Start:
1005870

Gene Stop:
1004863

Gene Length:
1008

Molecular Weight*:
37566

pI*:
5.80

Net Charge*:
-5.43

EC:
6.1.1.2  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Tryptophan metabolism

Secondary Evidence:
Hall,C.V., vanCleemput,M., Muench,K.H. and Yanofsky,C. The nucleotide sequence of the structural gene for Escherichia coli tryptophanyl-tRNA synthetase. J. Biol. Chem. 257 (11): 6132-6136 (1982) [Medline: 82189977].

Lyngstadaas,A., Lobner-Olesen,A. and Boye,E. Characterization of three genes in the dam-containing operon of Escherichia coli. Mol. Gen. Genet. 247 (5): 546-554 (1995) [Medline: 95327050].

Comment:
Oklahoma ID: NGO.1045c

Blast Summary:  PSI-Blast Search
NG1045 is orthologous to AL162756, N. meningitidis Z2491 tryptophanyl-tRNA synthetase: residues 1-336 have 96% similarity to residues 1-3365 in NG1045.

NG1045 also has strong (P-value < 1e-70) similarity to tryptophanyl-tRNA synthetase proteins in many other organisms; e.g. residues 5-336 are 60% similar to 11352731 of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0180
COG name: Tryptophanyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0180 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001412 (Aminoacyl-transfer RNA synthetases class-I) with a combined E-value of 8.1e-06.
    IPB001412A    10-20
    IPB001412B    200-210


ProDom Summary:  Protein Domain Search
Residues 18-325 are 34% similar to a (SYNTHETASE AMINOACYL-TRNA LIGASE PROTEIN BIOSYNTHESIS) protein domain (PD001451) which is seen in SYW_HAEIN.



Paralogs:  Local Blast Search


NG1045 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 288 (E-value = 1.4e-56) place NG1045 in the tRNA-synt_1b family which is described as tRNA synthetases class I (W and Y) (PF00579)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
278  
336

PDB Hit:
pdb|1I6K|1I6K-A 1.7 HIGH RESOLUTION EXPERIMENTAL PHASES FOR 166.0 7e-42
pdb|1D2R|1D2R-A 2.9 A CRYSTAL STRUCTURE OF LIGAND-FREE 163.0 3e-41
pdb|1H3E|1H3E-A TYROSYL-TRNA SYNTHETASE FROM THERMUS 40.6 4e-04
pdb|1D2R|1D2R-A 2.9

Gene Protein Sequence:
MSKKRVLTGVTTTGTPHLGNYVGAIRPAVRAAQNPDTESFLFLADYHGII
KCHEQEMIHQSTQAVAATWLACGLDPERTTFYRQSDIPEVMELNWILTCI
TAKGLMNRAHAYKAAVQANAENGQEDPDFGVEMGLFSYPILMTADILMFN
ANEVPVGRDQIQHVEMARDIAGRFNHRFQELFTLPEVKIDENVELLVGLD
GRKMSKSYGNTIPLWENDKKTQKSVNKIITNMKEPGEPKQPDESPLFEIY
KAFSTPSETAEFTQMLADGLAWGEAKKLSAAKINAELAELRERYNALTSN
PSQIEEILQAGAQKARKEARELLDKVRDAVGIRPLK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAAAAAACGAGTTCTGACCGGCGTAACCACCACCGGCACCCCGCA
TCTGGGCAACTACGTCGGCGCCATCCGCCCCGCCGTCCGCGCGGCGCAAA
ACCCCGATACCGAATCCTTCCTCTTCCTCGCCGATTACCACGGCATCATC
AAATGCCACGAGCAGGAGATGATTCACCAATCCACCCAAGCCGTTGCCGC
CACTTGGCTTGCCTGCGGACTCGACCCCGAGCGCACCACCTTCTACCGCC
AAAGCGACATTCCCGAAGTGATGGAGTTGAACTGGATTCTGACCTGCATC
ACCGCCAAGGGTTTGATGAACCGCGCCCACGCCTACAAAGCCGCCGTTCA
AGCCAATGCGGAAAACGGGCAGGAAGACCCCGATTTCGGTGTGGAAATGG
GTTTGTTCAGTTATCCGATTCTGATGACTGCCGACATTTTGATGTTCAAC
GCCAACGAAGTCCCCGTCGGGCGCGACCAAATCCAACACGTCGAAATGGC
GCGCGACATTGCCGGCCGCTTCAACCACCGTTTCCAAGAACTCTTCACCC
TGCCCGAAGTGAAAATCGACGAAAACGTCGAACTCTTGGTCGGTTTGGAC
GGACGCAAAATGTCCAAATCCTACGGCAATACCATTCCGCTTTGGGAAAA
CGACAAAAAAACCCAAAAATCGGTCAACAAAATCATTACCAACATGAAAG
AGCCGGGCGAGCCGAAACAGCCCGACGAAAGCCCTTTGTTTGAAATCTAT
AAAGCCTTCTCCACGCCGTCTGAAACGGCGGAATTTACGCAAATGCTTGC
CGACGGCTTGGCTTGGGGCGAGGCGAAAAAACTTTCGGCGGCGAAAATCA
ACGCCGAATTGGCAGAACTGCGCGAACGCTACAACGCATTGACCTCTAAT
CCTTCGCAAATCGAAGAGATTTTGCAGGCAGGCGCGCAAAAAGCGCGCAA
AGAAGCGCGCGAATTGTTGGATAAAGTACGCGATGCGGTCGGCATCCGCC
CGTTGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy