Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0838 IGR0844 IGR0846 IGR0842 IGR0840 IGR0845 IGR0841 IGR0839 IGR0843 NG1027 ssb, - NG1031 NG1025 NG1033 NG1030 NG1032 fixG, - NG1026 NG1034 fumC, - NG1029 tkt, - NG1028 NG1027 ssb, - NG1031 NG1025 NG1033 NG1030 NG1032 fixG, - NG1026 NG1034 fumC, - NG1029 tkt, - NG1028 NG1027 ssb, - NG1031 NG1025 NG1033 NG1030 NG1032 fixG, - NG1026 NG1034 fumC, - NG1029 tkt, - NG1028
* Calculated from Protein Sequence

Gene ID: NG1029

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fumC  

Definition:
fumarate hydratase (fumarase C)

Gene Start:
992677

Gene Stop:
994062

Gene Length:
1386

Molecular Weight*:
49271

pI*:
6.20

Net Charge*:
-5.37

EC:
4.2.1.2  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Citrate cycle (TCA cycle)
Reductive carboxylate cycle (CO2 fixation)

Secondary Evidence:
Woods,S.A., Miles,J.S., Roberts,R.E. and Guest,J.R. Structural and functional relationships between fumarase and aspartase. Nucleotide sequences of the fumarase (fumC) and aspartase (aspA) genes of Escherichia coli K12. Biochem. J. 237 (2): 547-557 (1986) [Medline: 87099873].

Ueda,Y., Yumoto,N., Tokushige,M., Fukui,K. and Ohya-Nishiguchi,H. Purification and characterization of two types of fumarase from Escherichia coli. J. Biochem. 109 (5): 728-733 (1991) [Medline: 92011457].

Weaver,T. and Banaszak,L. Crystallographic studies of the catalytic and a second site in fumarase C from Escherichia coli. Biochemistry 35 (44): 13955-13965 (1996) [Medline: 97065812].

Weaver,T., Lees,M. and Banaszak,L. Mutations of fumarase that distinguish between the active site and a nearby dicarboxylic acid binding site. Protein Sci. 6 (4): 834-842 (1997) [Medline: 97253450].

Comment:
From GenBANK (gi:120601): FumC catalyzes the reaction: l-malate = fumarate + H2O, involved in the tricarboxylic acid cycle. This homotetramer is similar to other thermostable class II fumarases.

Oklahoma ID: NGO.1029

Blast Summary:  PSI-Blast Search
NG1029 is orthologous to AL162756, N. meningitidis Z2491 fumarate hydratase class II: residues 1-462 have 98% similarity to residues 1-462 in NG1029.

NG1029 also have very strong (P-value < 1e-100) similarity to fumerate hydratase proteins in several other organisms; e.g. residues 1-459 are 57% similar to 12721130 of Pasteurella multocida.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0114
COG name: Fumarase
Functional Class:  C
The phylogenetic pattern of COG0114 is ----y--cebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000362 (Fumarate lyase) with a combined E-value of 6.7e-16.
    IPB000362A    184-197
    IPB000362B    316-326


ProDom Summary:  Protein Domain Search
Residues 183-459 are 64% similar to a (LYASE BIOSYNTHESIS ARGININOSUCCINATE FUMARATE HYDRATASE) protein domain (PD000660) which is seen in Q9ZJQ9_BBBBB.

Residues 25-182 are 53% similar to a (LYASE FUMARATE HYDRATASE FUMARASE) protein domain (PD002097) which is seen in O17214_CAEEL.



Paralogs:  Local Blast Search


NG1029 is paralogously related to NG0556 (aspartate ammonia-lyase) (1e-101), NG0219 (argininosuccinate lyase) (9e-12) and NG1711 (putative adenylosuccinate lyase (PurB)) (2e-04).


Pfam Summary:  Pfam Search
Residues 11 to 341 (E-value = 4.7e-166) place NG1029 in the Lyase_1 family which is described as Lyase (PF00206)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
184  
306

PDB Hit:
pdb|1FUO|1FUO-A FUMARASE C WITH BOUND CITRATE 535.0 0e+00
pdb|1FUP|1FUP-A FUMARASE WITH BOUND PYROMELLITIC ACID 535.0 0e+00
pdb|1KQ7|1KQ7-A E315Q MUTANT FORM OF FUMARASE C FROM E.COLI 534.0 0e+00
pdb|1FUR|1FUR-A FUMA

Gene Protein Sequence:
MNTRTEHDTMGNVEVPSEAYWGAQTQRSRNNFKIGGETLPQPLIYALALV
KKAAAATNVSLGRIKPEQADLITQAADDVLNGRLDGQFPLVVWQTGSGTQ
SNMNMNEVLANRANEIAGTGLAAYRPVHPNDHVNHAQSTNDAFPTAIHVA
AAIEINRHLIPAVKALRDTLDKKAQAFAPIVKIGRTHLQDATPLTLGQEF
SGYVSQLDHSLGRLNDALKGLYELALGGTAVGTGLNSHPEYAEIAAAKLA
ELSGLPFVSAPNKFEALGGRDAAVAASGALKTLAASLNKIANDIRWLASG
PRCGLGEIKIPENEPGSSIMPGKVNPTQCEAMTMVCCQVFGNDVTIGMAG
ASGNFELNVYMPVIAYNLLQSIRLLGDACNSFNENCAAGIEPVPEKIDYF
LHHSLMLVTALNRKIGYENAAKVAKTAYKNDKSLRETAVGLGLLTGEEFD
ELVVPADMVHPR

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACACCCGCACCGAACACGACACGATGGGCAATGTCGAAGTCCCGTC
CGAAGCCTATTGGGGCGCGCAGACCCAGCGCAGCCGCAACAATTTCAAAA
TCGGCGGCGAAACCCTGCCGCAGCCGCTGATTTACGCTTTGGCGTTGGTG
AAAAAAGCCGCCGCCGCGACCAATGTTTCCCTCGGCAGGATTAAGCCCGA
ACAGGCGGATTTGATTACGCAGGCGGCGGATGATGTACTGAACGGCAGGC
TCGACGGGCAGTTCCCCTTAGTGGTTTGGCAGACCGGCTCCGGTACGCAG
TCCAATATGAACATGAACGAAGTGCTGGCAAACCGCGCCAACGAAATTGC
AGGTACGGGTTTGGCGGCGTACCGGCCCGTCCACCCCAACGACCATGTGA
ACCACGCGCAATCGACCAACGACGCGTTCCCGACCGCCATCCACGTCGCC
GCCGCGATTGAAATCAACCGCCACCTTATTCCGGCGGTAAAAGCCTTGCG
CGATACATTGGACAAAAAAGCCCAAGCCTTCGCCCCCATCGTCAAAATCG
GCCGTACCCACTTGCAGGATGCGACGCCGCTGACTTTGGGACAAGAATTT
TCCGGCTACGTTTCCCAACTCGACCACAGCTTAGGCCGTCTGAACGACGC
GCTCAAAGGTTTGTACGAACTCGCCTTGGGTGGAACGGCGGTCGGTACGG
GTTTGAACAGCCATCCCGAATACGCTGAAATAGCCGCCGCCAAACTCGCC
GAACTGTCCGGCCTGCCGTTTGTCAGCGCGCCGAACAAATTTGAAGCCTT
GGGCGGACGCGATGCCGCCGTTGCCGCTTCGGGCGCATTGAAAACGCTGG
CGGCAAGCCTGAACAAAATCGCCAACGACATCCGCTGGCTGGCAAGCGGC
CCGCGCTGCGGCTTGGGCGAAATCAAAATCCCCGAAAACGAACCGGGTTC
GTCCATTATGCCGGGCAAAGTCAACCCGACCCAATGCGAAGCGATGACGA
TGGTGTGCTGCCAAGTGTTCGGCAACGACGTTACCATCGGTATGGCGGGC
GCGTCGGGCAATTTCGAGCTGAACGTCTATATGCCCGTCATCGCTTACAA
CCTCTTGCAATCCATCCGCCTCTTGGGCGACGCGTGCAACAGCTTCAACG
AAAACTGCGCCGCCGGCATCGAACCCGTACCGGAAAAAATCGACTATTTC
CTGCACCATTCCCTGATGCTGGTTACTGCGTTAAACCGCAAAATCGGCTA
CGAAAACGCCGCCAAAGTCGCCAAAACCGCCTACAAAAACGATAAATCGC
TGCGCGAAACTGCCGTTGGGTTGGGCTTGCTGACGGGCGAAGAGTTTGAC
GAACTGGTCGTCCCTGCCGATATGGTTCATCCGCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy