Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0838 IGR0844 IGR0842 IGR0840 IGR0841 IGR0839 IGR0837 IGR0843 NG1027 ssb, - NG1031 NG1025 NG1030 NG1032 fixG, - NG1026 NG1024 fumC, - NG1029 tkt, - NG1028 NG1027 ssb, - NG1031 NG1025 NG1030 NG1032 fixG, - NG1026 NG1024 fumC, - NG1029 tkt, - NG1028 NG1027 ssb, - NG1031 NG1025 NG1030 NG1032 fixG, - NG1026 NG1024 fumC, - NG1029 tkt, - NG1028
* Calculated from Protein Sequence

Gene ID: NG1028

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tkt  

Definition:
transketolase

Gene Start:
990554

Gene Stop:
992530

Gene Length:
1977

Molecular Weight*:
71568

pI*:
5.80

Net Charge*:
-12.70

EC:
2.2.1.1  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbon fixation
Pentose phosphate cycle

Secondary Evidence:
Sprenger,G.A. Nucleotide sequence of the Escherichia coli K-12 transketolase (tkt) gene. Biochim. Biophys. Acta 1216 (2): 307-310 (1993) [Medline: 94060107].

Comment:
From GenBANK (gi:2827767): This protein catalyzes the reaction: sedoheptulose 7-phosphate + d-glyceraldehyde 3-phosphate = d-ribose 5-phosphate + d-xylulose 5-phosphate, requiring a cofactor, thiamine pyrophosphate.

Oklahoma ID: NGO.1028

Blast Summary:  PSI-Blast Search
NG1028 is orthologous to AE002495, N. meningitidis MC58 transketolase: residues 1-659 have 97% similarity to residues 1-659 in AE002495, N. meningitidis MC58 transketolase.

NG1028 also has very strong similarity (P-value < 1e-100) to numerous transketolase proteins in other organisms; e.g. residues 3-659 are 64% similar to 1174714 of Haemophilus influenzae.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0021
COG name: Transketolase
Functional Class:  G
The phylogenetic pattern of COG0021 is -m--YqVCEbrhujgp-lin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000360 (Transketolase) with a combined E-value of 2.4e-50.
    IPB000360A    22-33
    IPB000360B    35-74
    IPB000360C    463-492


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1028 is paralogously related to NG0036 (1-deoxyxylulose-5-phosphate synthase (DXP synthase)) (2e-09) and NG0565 (pyruvate dehydrogenase, E1 component) (3e-05).


Pfam Summary:  Pfam Search
Residues 2 to 331 (E-value = 2.2e-234) place NG1028 in the Transketolase_N family which is described as Transketolase, thiamine diphosphate binding domain (PF00456)
Residues 352 to 523 (E-value = 2.7e-58) place NG1028 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)
Residues 545 to 651 (E-value = 9.7e-11) place NG1028 in the Transketolase_C family which is described as Transketolase, C-terminal domain (PF02780)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
263  
336
non-globular  
517  
610

PDB Hit:
pdb|1GPU|1GPU-A TRANSKETOLASE COMPLEX WITH REACTION INTERMEDIATE587.0 0e+00
pdb|1TKA|1TKA-A TRANSKETOLASE (E.C.2.2.1.1) COMPLEXED WITH 587.0 0e+00
pdb|1ITZ|1ITZ-A MAIZE TRANSKETOLASE IN COMPLEX WITH TPP 585.0 0e+00
pdb|1AY0|1AY0-A IDEN

Gene Protein Sequence:
MSQLANVIRFLSADAVQKANSGHPGAPMGMAEMAETLWTKFLNHNPANPK
FYNRDRFVLSNGHASMLLYSLLHLTGYNLSIEDLKNFRQLHSKTPGHPEY
GYTDGVETTTGPLGQGIANAVGMALAEKILAAEFNKDGLNIVDHYTYVFM
GDGCLMEGVSHEACSLAGTLGLGKLIVLYDDNNISIDGKVDGWFTENIPQ
RFESYGWHVVPNVNGHDTAAIQTAIEAARAETGKPSIICCKTLIGKGSAN
KEGSHKTHGAPLGADEIEATRKHLGWAYPAFEIPQEIYDAWNAKEKGAKL
EAGWNELFAQYQAKYPAEAAEFVRRMDKKLPENFDEYVQTALKEVCAKAE
TVATRKASQNSIEILAKELPELVGGSADLTPSNLTDWSNSVSVTRDKGGN
YIHYGVREFGMGAIMNGLVLHGGVKPFGATFLMFSEYERNALRMAALMKI
NPVFVFTHDSIGLGEDGPTHQPIEQTATLRLIPNMDVWRPCDTAESLVAW
AEAAKAEDHPSCLIFSRQNLKFQARSEQQLNDIKRGAYVISEAQGNAQAV
IIATGSEVGLAVEAQKVLAGQGIAVRVVSMPSTSVFDRQDAAYQAAVLPE
GLPRIAVEAGHTNGWYKYVGLNGAVVGINRFGESAPADLLFKAFGFTVDN
VVDTVKSVL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTCAACTGGCAAACGTAATCCGCTTCCTCTCGGCCGATGCCGTTCA
AAAAGCCAATTCCGGCCACCCCGGCGCGCCTATGGGTATGGCGGAAATGG
CGGAAACATTGTGGACGAAATTCCTCAATCACAATCCCGCCAATCCCAAA
TTCTACAACCGCGACCGCTTCGTCCTCTCCAACGGTCATGCGTCTATGCT
GTTGTACAGCCTGCTGCACCTGACCGGCTACAACCTGAGCATTGAAGATC
TGAAAAACTTCCGCCAGCTGCACAGCAAAACCCCCGGCCATCCCGAATAC
GGCTACACCGACGGCGTGGAAACCACGACCGGCCCGTTGGGGCAAGGTAT
TGCCAACGCAGTGGGCATGGCATTGGCAGAAAAAATCCTTGCCGCCGAAT
TTAATAAAGACGGTTTGAACATCGTCGATCACTACACTTACGTCTTTATG
GGCGACGGCTGCCTGATGGAAGGCGTATCGCACGAAGCCTGCTCACTCGC
CGGCACCTTGGGCTTGGGCAAACTGATTGTTTTGTATGACGATAACAATA
TCTCCATCGACGGCAAAGTGGACGGCTGGTTTACCGAAAACATCCCGCAA
CGCTTTGAAAGCTACGGCTGGCACGTCGTTCCCAACGTAAACGGCCACGA
CACCGCCGCCATTCAGACGGCCATCGAAGCCGCCCGCGCCGAAACCGGCA
AGCCGTCCATCATCTGCTGCAAAACCTTAATCGGCAAAGGCAGCGCCAAC
AAAGAAGGCAGCCACAAAACCCACGGCGCGCCTTTGGGTGCGGACGAAAT
CGAAGCCACGCGCAAACATTTGGGTTGGGCTTATCCTGCGTTTGAAATCC
CGCAAGAAATTTACGATGCGTGGAATGCCAAAGAAAAAGGCGCGAAACTG
GAAGCCGGATGGAACGAACTGTTCGCGCAATATCAAGCCAAATATCCTGC
CGAAGCCGCAGAATTCGTGCGCCGCATGGATAAAAAGCTGCCGGAAAACT
TTGACGAGTACGTTCAGACGGCATTGAAAGAAGTGTGCGCCAAAGCGGAA
ACCGTCGCCACCCGCAAAGCCAGCCAAAACAGCATCGAAATCTTGGCAAA
AGAGCTGCCCGAACTGGTGGGCGGTTCTGCCGACCTGACCCCGTCCAACC
TGACCGACTGGTCAAACAGCGTCTCCGTTACCCGCGACAAAGGCGGCAAC
TACATCCACTACGGCGTGCGCGAGTTCGGTATGGGTGCGATTATGAACGG
TTTGGTATTGCACGGCGGTGTAAAACCCTTCGGCGCGACTTTCCTGATGT
TCAGCGAATACGAACGCAACGCCTTACGCATGGCGGCACTGATGAAAATC
AACCCCGTCTTCGTATTTACCCACGATTCCATCGGTTTGGGCGAGGACGG
CCCAACCCACCAGCCTATCGAGCAAACCGCCACCCTGCGCCTGATTCCGA
ATATGGACGTATGGCGGCCGTGCGACACCGCAGAATCTCTGGTCGCTTGG
GCAGAAGCGGCAAAAGCCGAAGACCACCCGTCCTGCCTGATTTTCAGCCG
TCAAAACCTGAAATTCCAAGCACGCAGCGAGCAACAACTGAACGACATCA
AACGCGGTGCTTACGTAATCAGTGAAGCCCAAGGCAACGCCCAAGCCGTC
ATCATTGCCACCGGTTCCGAGGTAGGATTGGCTGTAGAAGCGCAAAAAGT
ATTGGCAGGACAAGGTATTGCCGTGCGCGTCGTTTCCATGCCGTCCACCA
GCGTCTTCGACCGCCAAGACGCCGCCTATCAAGCCGCCGTCCTACCGGAA
GGCCTGCCGCGCATCGCCGTAGAAGCCGGACACACCAACGGCTGGTACAA
ATATGTCGGACTGAACGGCGCAGTCGTCGGCATCAACCGCTTCGGCGAAT
CCGCCCCTGCCGATCTGCTGTTCAAAGCATTCGGCTTTACCGTGGACAAT
GTGGTTGATACGGTGAAATCCGTGCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy