Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Glu-2 tRNA-Arg-2 IGR0838 IGR0834 IGR0839 IGR0835 IGR0837 IGR0836 IGR0836.1 NG1027 NG1013 NG1025 dnaQ,polC, - NG1022 fixG, - NG1026 NG1014 NG1024 NG1020 NG1027 NG1013 NG1025 dnaQ,polC, - NG1022 fixG, - NG1026 NG1014 NG1024 NG1020 Type: tandem, Name:  - 42 NG1027 NG1013 NG1025 dnaQ,polC, - NG1022 fixG, - NG1026 NG1021 NG1021 NG1024 NG1020 NG1015 NG1014 NG1015
* Calculated from Protein Sequence

Gene ID: NG1022

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaQ  polC  

Definition:
DNA polymerase III (possible epsilon subunit)

Gene Start:
985733

Gene Stop:
984969

Gene Length:
765

Molecular Weight*:
28220

pI*:
6.50

Net Charge*:
-1.78

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
DNA polymerase
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
Al Mamun AA, Marians KJ, Humayun MZ.
DNA polymerase III from Escherichia coli cells expressing mutA mistranslator tRNA is error-prone.
J Biol Chem. 2002 Nov;277(48):46319-27.
PMID: 12324458

Foster KA, Barnes MH, Stephenson RO, Butler MM, Skow DJ, LaMarr WA, Brown NC.
DNA polymerase III of Enterococcusfaecalis: expression and characterization of recombinant enzymes encoded by the polC and dnaE genes.
Protein Expr Purif. 2003 Jan;27(1):90-7.
PMID: 12509989

Ason B, Handayani R, Williams CR, Bertram JG, Hingorani MM, O'Donnell M, Goodman MF, Bloom LB.
Mechanism of loading the Escherichia coli DNA polymerase III beta sliding clamp: Bona fide primer/templates preferentially trigger the gamma complex to hydrolyze ATP and load the clamp.
J Biol Chem. 2003 Jan.
PMID: 12519754

Rocha E.
Is there a role for replication fork asymmetry in the distribution of genes in bacterial genomes?.
Trends Microbiol. 2002 Sep;10(9):393-5.
PMID: 12217498

Barnes MH, Miller SD, Brown NC.
DNA polymerases of low-GC gram-positive eubacteria: identification of the replication-specific enzyme encoded by dnaE.
J Bacteriol. 2002 Jul;184(14):3834-8.
PMID: 12081953

Grompone G, Seigneur M, Ehrlich SD, Michel B.
Replication fork reversal in DNA polymerase III mutants of Escherichia coli: a role for the beta clamp.
Mol Microbiol. 2002 Jun;44(5):1331-9.
PMID: 12028381

Comment:


Blast Summary:  PSI-Blast Search
Residues 23-167 are 37% similar to L47709, which has a 22.4% identity with Escherichia coli DNA-damage inducible protein; putative from Bacillus subtilis.

Residues 23-170 are 32% similar to residues 423-573 in JH0232, a DNA-directed DNA polymerase (EC 2.7.7.7) III alpha chain (version 1) from Bacillus subtilis.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0847
COG name: DNA polymerase III epsilon subunit (3'-5' exonuclease)
Functional Class:  L
The phylogenetic pattern of COG0847 is a---YQvcEbRHuj---lINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG1022 is paralogously related to NG0973 (DNA polymerase III, epsilon chain) (9e-11).


Pfam Summary:  Pfam Search
Residues 21 to 175 (E-value = 3.6e-31) place NG1022 in the Exonuc_X-T family which is described as Exonuclease (PF00929)

PDB Hit:
pdb|1J53|1J53-A STRUCTURE OF THE N-TERMINAL EXONUCLEASE DOMAIN 53.5 4e-08

Gene Protein Sequence:
MIVVSRWPLLEKAFLRFGMPVAVVDLESTGGNLYEDRVTEVALVKFGQGR
AERYEWLVNPQKPIPKFVAELTGISDGMVADAPVFAEIAGGLFSVLKGCV
LVAHNSRFDYTFLKHEFHRAGIGFSSPALCSVQLSRRLYPQFYKHSLDGI
IERLGIVVEDRHRAMADVSALCDYLEYSLSAHGLEEWSRQCFRLTNPKLF
PAALPERLREQLYGLPDGTGVLACFDGGGKVNYIGTFERAYGEVAALLDS
GKAPV

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGTTGTTTCCCGCTGGCCCTTGCTGGAAAAGGCGTTTTTACGGTT
TGGAATGCCTGTTGCCGTGGTTGATTTGGAATCGACGGGCGGCAATCTGT
ATGAAGACAGGGTAACCGAAGTGGCTTTGGTCAAGTTTGGGCAGGGAAGG
GCGGAGAGGTATGAATGGCTGGTCAATCCTCAAAAACCGATTCCGAAGTT
TGTGGCGGAACTGACGGGGATTTCAGACGGCATGGTTGCCGACGCGCCGG
TGTTTGCTGAAATTGCCGGCGGGTTGTTTTCGGTATTGAAGGGGTGCGTG
CTGGTGGCGCACAACAGCCGTTTCGACTATACGTTTTTAAAGCATGAGTT
TCATCGTGCGGGTATCGGATTTTCATCGCCTGCTTTGTGCAGTGTGCAGC
TTTCGCGTCGGCTGTATCCGCAGTTTTACAAGCACAGCCTGGACGGTATC
ATCGAAAGGTTGGGGATTGTTGTGGAAGACAGGCATCGTGCGATGGCGGA
TGTATCGGCGTTGTGTGATTATTTGGAATACAGCCTGTCGGCACACGGGC
TTGAGGAGTGGAGCAGGCAGTGTTTCCGTTTGACGAATCCGAAACTTTTT
CCTGCCGCGCTTCCCGAACGGTTGAGGGAACAGCTGTACGGTTTGCCCGA
CGGTACAGGTGTGCTTGCCTGTTTCGACGGCGGGGGAAAAGTAAATTATA
TCGGTACGTTTGAACGGGCATATGGCGAGGTTGCGGCTTTGTTGGATTCC
GGAAAAGCCCCCGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy