Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-1 IGR0812 IGR0816 IGR0814 IGR0814.1 IGR0811 IGR0815 IGR0813 IGR0811.1 smpB,ssr, - NG0986 araC, - NG0990 adaB,ogt, - NG0988 rfaF,lsi,waaF, - NG0987 dapE, - NG0991 virG,icsA, - NG0985 NG0989 NG0984 smpB,ssr, - NG0986 araC, - NG0990 adaB,ogt, - NG0988 rfaF,lsi,waaF, - NG0987 dapE, - NG0991 virG,icsA, - NG0985 NG0989 NG0984 smpB,ssr, - NG0986 araC, - NG0990 adaB,ogt, - NG0988 rfaF,lsi,waaF, - NG0987 dapE, - NG0991 virG,icsA, - NG0985 NG0989 NG0984
* Calculated from Protein Sequence

Gene ID: NG0987

DNA Molecule Name:
1  

Genbank ID:
599920

Gene Name:
rfaF  lsi  waaF  

Definition:
ADP-heptose--LPS heptosyltransferase II

Gene Start:
958841

Gene Stop:
957834

Gene Length:
1008

Molecular Weight*:
37540

pI*:
7.60

Net Charge*:
2.90

EC:
2.4.99.-  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Blood group glycolipid biosynthesis - neolact series
Lipopolysaccharide biosynthesis
Sphingoglycolipid metabolism

Primary Evidence:
Schwan,E.T., Robertson,B.D., Brade,H. and van Putten,J.P.,
Gonococcal rfaF mutants express Rd2 chemotype LPS and do not enter epithelial host cells,
Mol. Microbiol. 15 (2), 267-275 (1995)
Medline: 95264913

Petricoin,E.F. III., Danaher,R.J. and Stein,D.C.
Analysis of the lsi region involved in lipooligosaccharide
biosynthesis in Neisseria gonorrhoeae
J. Bacteriol. 173 (24), 7896-7902 (1991)
Medline: 92078097

Jennings,M.P., Bisercic,M., Dunn,K.L., Virji,M., Martin,A., Wilks,K.E., Richards,J.C. and Moxon,E.R.
Cloning and molecular analysis of the Isi1 (rfaF) gene of Neisseria meningitidis which encodes a heptosyl-2-transferase involved in LPS biosynthesis: evaluation of surface exposed carbohydrates in LPS mediated toxicity for human endothelial cells
Microb. Pathog. 19 (6), 391-407 (1995)
Medline: 97004969



Secondary Evidence:
Petricoin,E.F. III., Danaher,R.J. and Stein,D.C.,
Analysis of the lsi region involved in lipooligosaccharide biosynthesis in Neisseria gonorrhoeae,
J. Bacteriol. 173 (24), 7896-7902 (1991)

Pegues,J.C., Chen,L.S., Gordon,A.W., Ding,L. and Coleman,W.G. Jr.
Cloning, expression, and characterization of the Escherichia coli
K-12 rfaD gene
J. Bacteriol. 172 (8), 4652-4660 (1990)
Medline: 90330578

Chen,L. and Coleman,W.G. Jr.
Cloning and characterization of the Escherichia coli K-12 rfa-2
(rfaC) gene, a gene required for lipopolysaccharide inner core
synthesis
J. Bacteriol.175 (9),2534-2540 (1993)
Medline: 93239678



Comment:
For other 'rfa' genes, see NG0403 (rfaD), NG0402 (rfaE), NG1354 (rfaK), NG1934 (rfaC).


Oklahoma ID: NGO.987c

Blast Summary:  PSI-Blast Search
NG0987 is 99% identical to a previously sequenced Neisseria gonorrhoeae protein in GenBank, 599920.

Residues 1-336 are 96% similar to lipopolysaccharide heptosyltransferase from Neisseria meningitidis group A strain Z2491 (11279323|).

Numerous hits in gapped BLAST to lipopolysaccharide heptosyltransferase sequences,e.g.residues 3-336 are 52% similar to heptosyltransferase II from Pseudomonas aeruginosa strain PAO1 (11348683|).Residues 3-330 are 45% similar to ADP-heptose--lps heptosyltransferase II from Escherichia coli O157:H7 EDL933 (12518376|).


COGS Summary:  COGS Search
BeTs to 4 clades of COG0859
COG name: ADP-heptose:LPS heptosyltransferase
Functional Class:  M
The phylogenetic pattern of COG0859 is -----Q-cE--HUJ-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002201 (Glycosyltransferase family 9) with a combined E-value of 2.4e-38.
    IPB002201A    14-38
    IPB002201B    242-285


ProDom Summary:  Protein Domain Search
Residues 142-173 are 96% similar to a (LSI TRANSFERASE LIPOOLIGOSACCHARIDE BIOSYNTHESIS REGION) protein domain (PD023977) which is seen in Q51063_NEIGO.

Residues 4-141 are 90% similar to a (TRANSFERASE II HEPTOSYLTRANSFERASE) protein domain (PD004673) which is seen in Q51063_NEIGO.

Residues 176-313 are identical to a (TRANSFERASE HEPTOSYLTRANSFERASE PROTEIN) protein domain (PD002299) which is seen in Q51004_NEIGO.



Paralogs:  Local Blast Search


NG0987 is paralogously related to NG1934 (lipopolysaccharide heptosyltransferase) (4e-07).


Pfam Summary:  Pfam Search
Residues 71 to 318 (E-value = 4e-123) place NG0987 in the Glyco_transf_9 family which is described as Glycosyltransferase family 9 (heptosyltransferase) (PF01075)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
86  
102

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MSIKILIISPSWIGDCVMTQPLFRRLKKLHPGCTIDVFAPKWSMAVFERM
PEVNEILENPFGHGALELKRRWRVGRELGRRGYDRVIVLPGSLKSAVIAL
ATGIGKRTGYVGESRYFLLNDIRRLDKERLPLMVDRYTALAHQSQEDFDG
HSGFPEFSIDERRREISVETFGLNLGKPVLAFCPGAEFGPAKRWPARHFA
ELGKHYSEAGWQVWLFGSQKDNEIAEEINCLSDGMCVNLCGKTDLSQAMD
LLSLADTVVCNDSGLMHLAAALGRKVVAVYGSSSPTHTPPLSDRAKIVSL
HLECSPCFKRECPLGHTDCLNRLYPEKIVQAVEEAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTATCAAAATCCTGATTATTTCTCCCAGTTGGATAGGCGACTGCGT
GATGACCCAGCCCTTGTTCCGCCGTTTGAAGAAACTTCATCCCGGTTGCA
CGATTGATGTGTTCGCACCGAAGTGGTCGATGGCGGTGTTCGAGCGTATG
CCGGAAGTGAATGAGATTCTTGAAAATCCGTTCGGACACGGTGCGTTGGA
GCTGAAACGCCGTTGGCGGGTCGGCAGGGAGTTGGGACGGCGCGGATACG
ACAGGGTTATCGTGTTGCCGGGTTCTTTGAAGTCGGCAGTCATCGCGCTG
GCAACGGGCATCGGAAAAAGAACGGGTTATGTCGGCGAAAGCCGTTATTT
TCTGTTGAACGATATACGCAGGCTGGATAAGGAACGTCTGCCTTTGATGG
TGGACCGATATACGGCTCTCGCGCATCAGAGTCAGGAAGATTTTGACGGG
CATTCGGGATTCCCCGAGTTTTCCATTGATGAACGGCGGCGGGAAATTTC
TGTCGAAACTTTCGGTTTGAATCTTGGAAAGCCTGTTCTGGCTTTTTGCC
CGGGTGCGGAATTCGGGCCGGCAAAGCGTTGGCCGGCAAGGCATTTTGCC
GAGTTGGGCAAACACTATTCGGAGGCGGGTTGGCAGGTTTGGTTGTTCGG
TTCGCAAAAAGATAATGAAATCGCCGAAGAAATCAACTGCCTTTCAGACG
GCATGTGTGTCAATTTGTGCGGCAAAACCGATTTGTCGCAGGCAATGGAT
TTGCTGTCGTTGGCGGACACGGTCGTGTGCAACGACAGCGGGCTGATGCA
TTTGGCGGCTGCTTTGGGCAGGAAGGTAGTGGCGGTTTACGGTTCTTCCA
GCCCGACGCATACGCCGCCTTTGAGCGACAGGGCGAAAATCGTCAGCCTG
CACTTGGAATGTTCGCCCTGTTTCAAACGTGAATGCCCGTTGGGGCATAC
CGACTGCCTCAACAGGCTGTATCCCGAGAAGATTGTGCAGGCGGTTGAAG
AGGCGGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy