Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0802 IGR0795.1 IGR0800 IGR0798 IGR0799 IGR0801 IGR0797 IGR0796 IGR0803 IGR0804 NG0976 ispF, - NG0971 rpiA, - NG0970 ispD, - NG0972 nuc, - NG0969 dnaQ,dp3E, - NG0973 NG0968 NG0974 dsbD, - NG0978 NG0967 NG0965 NG0964 ackA, - NG0977 NG0976 ispF, - NG0971 rpiA, - NG0970 ispD, - NG0972 nuc, - NG0969 dnaQ,dp3E, - NG0973 NG0968 NG0974 dsbD, - NG0978 NG0967 NG0965 NG0964 ackA, - NG0977 ispF, - NG0971 rpiA, - NG0970 ispD, - NG0972 nuc, - NG0969 dnaQ,dp3E, - NG0973 NG0968 NG0974 dsbD, - NG0978 fixS, - NG0975 NG0976 fixS, - NG0975 NG0964 ackA, - NG0977 NG0965 NG0967
* Calculated from Protein Sequence

Gene ID: NG0973

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaQ  dp3E  

Definition:
DNA polymerase III, epsilon chain

Gene Start:
944528

Gene Stop:
943797

Gene Length:
732

Molecular Weight*:
27137

pI*:
4.60

Net Charge*:
-15.71

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
DNA polymerase
Purine metabolism
Pyrimidine metabolism

Secondary Evidence:
O'Donnell,M. Accessory protein function in the DNA polymerase III holoenzyme from E. coli. Bioessays 14 (2), 105-111 (1992) Medline: 92246902.
Takano,K., Nakabeppu,Y., Maki,H., Horiuchi,T. and Sekiguchi,M. Structure and function of dnaQ and mutD mutators of Escherichia coli. Mol. Gen. Genet. 205 (1): 9-13 (1986) [Medline: 87089093].
Cox,E.C. and Horner,D.L. DNA sequence and coding properties of mutD(dnaQ) a dominant Escherichia coli mutator gene. J. Mol. Biol. 190 (1): 113-117 (1986) [Medline: 87060973].

Comment:
Oklahoma ID: NGO.973c

From GenBANK (gi:118808): DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity. The tau chain serves as a scaffold to help in the dimerizaton of the core complex. The gamma chain seems to interact with the delta subunit to transfer the beta subunit on the DNA. The reaction: N deoxynucleoside triphosphate = N pyrophosphate + DNA(N). The enzyme contains a core (composed of alpha, epsilon, and theta chains) that associates with a tau subunit which allow the core dimerization to form the PolIII' complex. PolIII' associates with the gamma complex (composed of chains gamma, delta, delta', psi, and chi) and with the beta chain. The final composition of the complex is: (alpha,epsilon,theta)[2]-tau[2]-(gamma,delta,delta', psi,chi)[2]-beta[4]. The production of the two protein products from this region is due to programmed ribosomal frameshifting. Partial similarity to phage T4 DNA polymerase accessory protein 44 and to human activator 1, 37 and 40 kda subunits.

For a review of DNA Pol III, see O'Donnell,M. Accessory protein function in the DNA polymerase III holoenzyme from E. coli. Bioessays 14 (2), 105-111 (1992) Medline: 92246902.

For other 'dna' genes, see NG0002 (dnaN), NG0078 (dnaE), NG0235 (dnaJ), NG0451 (dnaB), NG0485 (dnaB), NG0551 (dnaJ), NG0001 (dnaA), NG0998 (dnaG), NG1110 (dnaC), NG1429 (dnaK), NG1636 (dnaC) and NG1901 (dnaJ). For other pol III subunits, see NG0078 (alpha), NG0283 (delta), NG0347 (delta prime), NG0743 (gamma-tau), NG0002 (beta), NG1226 (chi).

Blast Summary:  PSI-Blast Search
NG0973 is orthologous to AL162756, N. meningitidis Z2491; residues 1-244 have 95% similarity to residues 1-244 in NG0973.

NG0973 also has strong (P-value < 1e-40) similarity to DNA polymerase III, epsilon chain proteins in several other organisms.


COGS Summary:  COGS Search
BeTs to 10 clades of COG0847
COG name: DNA polymerase III epsilon subunit (3'-5' exonuclease)
Functional Class:  L
The phylogenetic pattern of COG0847 is a---YQvcEbRHuj---lINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 6-98 are 48% similar to a (DNA III POLYMERASE CHAIN) protein domain (PD002851) which is seen in Q9ZCJ9_RICPR.

Residues 99-222 are 46% similar to a (DNA POLYMERASE III EPSILON) protein domain (PD165942) which is seen in DP3E_SALTY.



Paralogs:  Local Blast Search


NG0973 is paralogously related to NG1022 (DNA polymerase III (possible epsilon subunit)) (8e-11).


Pfam Summary:  Pfam Search
Residues 5 to 169 (E-value = 2.9e-33) place NG0973 in the Exonuc_X-T family which is described as Exonuclease (PF00929)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
163  
244

PDB Hit:
pdb|1J53|1J53-A STRUCTURE OF THE N-TERMINAL EXONUCLEASE DOMAIN 178.0 6e-46

Gene Protein Sequence:
MMTRQIILDTETTGLYADGGDRLVEFAGLEMVNRQMTDKNLHLYVHPERD
MPEEAARVHGLTIQVLEEKNAPPFAEVGRQIADFLRGAELIIHNAKFDVG
FLNMEFRRVGLPTVEELGCTVTDTLAMAREMFPGQKASLDALCNRFSVDR
SKRVLHGALIDCELLGEVYLAMTRRQFDLMGETEEEEPTAKPVASAEMKL
GAKLKVIKADEAELAAHEEYLDGLGEACIWRKEAVPSENGGENA

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGACACGCCAAATCATCCTCGATACCGAAACCACCGGCCTGTATGC
CGACGGCGGCGACCGTCTGGTCGAGTTTGCCGGTCTGGAAATGGTCAACC
GCCAAATGACCGACAAAAACCTGCACCTCTATGTCCACCCCGAGCGCGAT
ATGCCCGAAGAGGCGGCACGCGTCCACGGCTTGACGATACAGGTTTTGGA
AGAGAAAAACGCGCCGCCGTTTGCAGAGGTCGGCAGGCAGATTGCCGATT
TTCTGCGCGGTGCGGAACTGATTATCCACAATGCCAAATTCGATGTGGGC
TTCCTCAATATGGAGTTCCGCCGGGTGGGGCTGCCGACCGTCGAGGAACT
CGGCTGCACCGTTACCGATACCCTGGCGATGGCGCGCGAAATGTTTCCGG
GGCAGAAAGCGAGCCTGGATGCCCTGTGCAACCGTTTTTCCGTCGACCGC
AGCAAGCGCGTCCTGCACGGCGCATTGATCGACTGCGAACTTTTGGGCGA
AGTCTATCTGGCGATGACGCGGCGGCAATTCGACTTGATGGGGGAGACCG
AGGAGGAAGAACCGACAGCCAAACCTGTTGCATCTGCCGAAATGAAACTC
GGTGCCAAACTGAAAGTGATTAAGGCGGATGAAGCCGAACTGGCGGCGCA
CGAAGAATATCTCGACGGCTTGGGCGAAGCCTGTATTTGGCGTAAGGAAG
CCGTGCCGTCTGAAAACGGCGGGGAAAACGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy