Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0802 IGR0795.1 IGR0800 IGR0798 IGR0799 IGR0801 IGR0797 IGR0796 IGR0803 IGR0804 NG0976 ispF, - NG0971 rpiA, - NG0970 ispD, - NG0972 nuc, - NG0969 dnaQ,dp3E, - NG0973 NG0968 NG0974 NG0967 NG0965 NG0964 ackA, - NG0977 NG0976 ispF, - NG0971 rpiA, - NG0970 ispD, - NG0972 nuc, - NG0969 dnaQ,dp3E, - NG0973 NG0968 NG0974 NG0967 NG0965 NG0964 ackA, - NG0977 ispF, - NG0971 rpiA, - NG0970 ispD, - NG0972 nuc, - NG0969 dnaQ,dp3E, - NG0973 NG0968 NG0974 fixS, - NG0975 NG0976 fixS, - NG0975 NG0965 NG0964 ackA, - NG0977 NG0967
* Calculated from Protein Sequence

Gene ID: NG0972

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ispD  

Definition:
4-diphosphocytidyl-2C-methyl-D-erthyritol synthase (MEP cytidyltransferase) (MCT)

Gene Start:
943797

Gene Stop:
943111

Gene Length:
687

Molecular Weight*:
24452

pI*:
6.90

Net Charge*:
-0.13

EC:
2.7.7.60  

Functional Class:
Other categories; Other  

Pathway: pathway table
Sterol biosynthesis

Secondary Evidence:
Rohdich,F., Wungsintaweekul,J., Fellermeier,M., Sagner,S., Herz,S., Kis,K., Eisenreich,W., Bacher,A. and Zenk,M.H. Cytidine 5'-triphosphate-dependent biosynthesis of isoprenoids: YgbP protein of Escherichia coli catalyzes the formation of4-diphosphocytidyl-2- C-methylerythritol. Proc. Natl. Acad. Sci. U.S.A. 96 (21): 11758-11763 (1999) [Medline: 99449755].

Kuzuyama,T., Takagi,M., Kaneda,K., Dairi,T. and Seto,H. Formation of 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol from 2-C-methyl-D-erythritol 4-phosphate by 2-C-methyl-D-erythritol4-phosphate cytidylyltransferase, a new enzyme in the nonmevalonate pathway. Tetrahedron Lett. 41, 703-706 (2000)

Comment:
For other 'ispF'genes see NG0971 (ispF),NG1675 (ispB) and NG1735 (ispA).

From GenBANK (gi:2833415): This protein catalyzes the formation of 4-diphosphocytidyl-2c-methyl-d-erythritol from CTP and 2c-methyl-d-erythritol 4-phosphate. Its optimal pH is 8.3, and it requires a cofactor: magnesium, manganese or cobalt. It is involved in the deoxyxylulose-5-phosphate pathway (dxp) of isoprenoid biosynthesis; third step.

Oklahoma ID: NGO.972c

Blast Summary:  PSI-Blast Search
NG0972 is orthologous to AL162756, N. meningitidis Z2491 4-diphosphocytidyl-2C-methyl-D-erthyritol synthase (MEP cytidyltransferase) (MCT): residues 1-229 have 92% similarity to residues 1-229 in NG0972.

NG0972 also has strong similarity to MCT proteins in many other organisms; e.g. residues 1-226 are 42% similar to 2811032 of Haemophilus influenzae.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1211
COG name: 4-diphosphocytidyl-2-methylerithritol synthase
Functional Class:  I
The phylogenetic pattern of COG1211 is ---k-qvcebrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001228 (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) with a combined E-value of 3.1e-71.
    IPB001228A    7-39
    IPB001228B    78-90
    IPB001228C    104-113
    IPB001228D    133-145
    IPB001228E    155-179
    IPB001228F    188-219


ProDom Summary:  Protein Domain Search
Residues 2-144 are 32% similar to a (TRANSFERASE PYROPHOSPHORYLASE PROTEIN BIOSYNTHESIS) protein domain (PD000318) which is seen in Q48230_HAEIN.

Residues 140-226 are 51% similar to a (PROTEIN INTERGENIC REGION SUGAR) protein domain (PD006861) which is seen in YGBP_ECOLI.

Residues 8-124 are 34% similar to a (PROTEIN 229AA LONG SLR0951 NIFR3 5'REGION ORF2 RV3582C) protein domain (PD105465) which is seen in O58136_PYRHO.



Paralogs:  Local Blast Search

NG0972 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 223 (E-value = 4.4e-61) place NG0972 in the IspD family which is described as Uncharacterized protein family UPF0007 (PF01128)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
19

PDB Hit:
pdb|1I52|1I52-A CRYSTAL STRUCTURE OF 4-DIPHOSPHOCYTIDYL-2-C- 165.0 6e-42

Gene Protein Sequence:
MKRKNIALIPAAGIGVRFGADKPKQYVEIGSKTVLEHVLGIFERHEAVDL
TVVVVSPEDTFADKVQTAFPQVRVWKNGGQTRAETVRNGVAKLLETGLAA
ETDNILVHDAARCCLPSEALARLIEQAGNAAEGGILAVPVADTLKRAESG
QISATVDRSGLWQAQTPQLFQAGLLHRALAAENLGGITDEASAVEKLGVR
PLLIQGDARNLKLTQPQDAYIVRLLLNAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACGCAAAAATATCGCGCTGATTCCCGCCGCCGGCATCGGGGTGCG
TTTCGGTGCGGACAAACCCAAGCAATATGTCGAAATCGGAAGCAAAACCG
TTTTAGAACATGTACTTGGGATTTTTGAACGGCATGAGGCCGTCGATTTG
ACCGTCGTTGTCGTCTCGCCCGAAGACACGTTTGCCGATAAGGTTCAGAC
GGCATTTCCACAGGTTCGGGTGTGGAAAAACGGTGGACAGACCCGCGCCG
AAACTGTCCGCAACGGTGTGGCAAAACTGTTGGAAACCGGTTTGGCGGCG
GAAACCGACAATATTCTGGTACACGATGCCGCCCGCTGCTGCCTGCCGTC
TGAAGCTCTGGCGCGGTTGATAGAACAGGCGGGCAACGCCGCCGAAGGCG
GGATTTTGGCAGTTCCCGTTGCCGATACGCTCAAGCGCGCAGAAAGCGGA
CAAATCAGTGCAACTGTCGACCGTTCGGGGCTTTGGCAGGCGCAAACGCC
GCAGCTTTTTCAAGCGGGTTTGCTGCACCGCGCATTGGCTGCGGAAAACT
TGGGCGGCATTACCGATGAAGCGTCCGCCGTGGAAAAACTGGGTGTGCGT
CCGCTACTGATACAGGGCGACGCGCGCAATTTGAAACTGACGCAGCCGCA
GGACGCATACATCGTCAGGCTGCTGCTCAATGCCGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy