Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0802 IGR0795.1 IGR0800 IGR0798 IGR0799 IGR0801 IGR0797 IGR0796 IGR0803 IGR0795 NG0976 ispF, - NG0971 rpiA, - NG0970 ispD, - NG0972 nuc, - NG0969 dnaQ,dp3E, - NG0973 NG0968 NG0974 NG0967 NG0965 NG0964 ackA, - NG0977 syr, - NG0963 NG0976 ispF, - NG0971 rpiA, - NG0970 ispD, - NG0972 nuc, - NG0969 dnaQ,dp3E, - NG0973 NG0968 NG0974 NG0967 NG0965 NG0964 ackA, - NG0977 syr, - NG0963 ispF, - NG0971 rpiA, - NG0970 ispD, - NG0972 nuc, - NG0969 dnaQ,dp3E, - NG0973 NG0968 NG0974 fixS, - NG0975 NG0976 fixS, - NG0975 NG0965 NG0964 ackA, - NG0977 syr, - NG0963 NG0967
* Calculated from Protein Sequence

Gene ID: NG0970

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpiA  

Definition:
ribose 5-phosphate isomerase

Gene Start:
942507

Gene Stop:
941848

Gene Length:
660

Molecular Weight*:
23542

pI*:
5.00

Net Charge*:
-6.36

EC:
5.3.1.6  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbon fixation
Pentose phosphate cycle

Secondary Evidence:
Hove-Jensen,B. and Maigaard,M. Escherichia coli rpiA gene encoding ribose phosphate isomerase A . J. Bacteriol. 175 (17): 5628-5635 (1993) [Medline: 93374859].

Rex,J.H., Aronson,B.D. and Somerville,R.L. The tdh and serA operons of Escherichia coli: mutational analysis of the regulatory elements of leucine-responsive genes. J. Bacteriol. 173 (19): 5944-5953 (1991) [Medline: 92011350].

Comment:
From GenBANK (gi:1173141): This protein catalyzes the reaction: (d-ribose 5-phosphate = d-ribulose 5-phosphate) of the nonoxidative branch of the pentose phosphate pathway. It belongs to the ribose 5-phosphate isomerase family.

Oklahoma ID: NGO.970c

Blast Summary:  PSI-Blast Search
NG0970 is orthologous to AE002500, N. meningitidis MC58 ribose 5-phosphate isomerase A: residues 4-223 have 98% similarity to residues 1-220.

NG0970 also has strong similarity (P-value < 1e-50) to ribose 5-phosphate isomerase A proteins in several other organisms; e.g. residues 1-215 are 53% similar to 1173141 of Haemophilus influenzae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0120
COG name: Ribose 5-phosphate isomerase
Functional Class:  G
The phylogenetic pattern of COG0120 is amtky--ce--h----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-215 are 53% similar to a (ISOMERASE RIBOSE 5-PHOSPHATE PHOSPHORIBOISOMERASE A) protein domain (PD005813) which is seen in RPIA_HAEIN.



Paralogs:  Local Blast Search


NG0970 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 45 to 213 (E-value = 2.1e-87) place NG0970 in the Rib_5-P_isom_A family which is described as Ribose 5-phosphate isomerase A (phosphoriboisomerase A) (PF06026)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1M0S|1M0S-A NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG 224.0 1e-59
pdb|1KS2|1KS2-A CRYSTAL STRUCTURE ANALYSIS OF THE RPIA, 220.0 2e-58
pdb|1LK5|1LK5-A STRUCTURE OF THE D-RIBOSE-5-PHOSPHATE ISOMERASE 156.0 4e-39
pdb|1KS2|1KS2-A CRYS

Gene Protein Sequence:
QDELKRIAAEKAVEFVPENEYIGIGTGSTINFFIEALGKSGKKIKGAVST
SKKSGELLARYDIPVVSLNEVSGLAVYIDGADEVNHALQMIKGGGGAHLN
EKIVASASEKFVCIADESKYVSRLGKFPLPVEAVESARSLVSRKLLAMGG
QPELRIGYTTFYGNQIVDVHGLNIDQPLTMEDEINKITGVLENGIFARDA
ADVLILGTEEGAKVIYPCQG

Gene Nucleotide Sequence:  Sequence Viewer
CAAGACGAACTCAAGCGCATCGCCGCCGAAAAAGCAGTCGAATTCGTACC
CGAAAACGAATACATCGGCATCGGTACCGGTTCGACCATCAATTTCTTCA
TCGAAGCCTTGGGCAAAAGCGGTAAAAAAATCAAAGGCGCGGTTTCAACC
TCCAAAAAATCCGGCGAACTGCTTGCCCGGTACGACATTCCCGTCGTGTC
CCTGAACGAAGTGTCCGGTTTGGCGGTCTATATCGACGGTGCGGACGAAG
TGAACCACGCCCTGCAAATGATTAAGGGCGGCGGCGGCGCGCACCTCAAC
GAAAAAATCGTCGCCAGCGCATCAGAAAAATTCGTCTGCATTGCGGACGA
AAGCAAATATGTTTCCCGGCTGGGCAAATTCCCACTGCCCGTGGAAGCCG
TCGAAAGCGCGCGCTCCCTTGTTTCGCGCAAACTGCTTGCCATGGGCGGA
CAGCCCGAACTGCGTATCGGCTACACCACGTTTTACGGCAACCAAATCGT
CGATGTCCACGGCTTGAATATCGATCAGCCGCTGACGATGGAAGATGAAA
TCAACAAAATCACCGGCGTACTCGAAAACGGCATATTCGCCCGCGATGCC
GCCGATGTGTTGATTTTGGGGACGGAAGAGGGTGCGAAAGTCATCTATCC
CTGCCAAGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy