Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0795.1 IGR0798 IGR0791 IGR0794 IGR0797 IGR0796 IGR0792 IGR0793 IGR0795 NG0959 rpiA, - NG0970 nuc, - NG0969 rph,rnpH, - NG0958 NG0968 NG0967 NG0965 hesA, - NG0960 NG0964 pncB, - NG0962 syr, - NG0963 NG0959 rpiA, - NG0970 nuc, - NG0969 rph,rnpH, - NG0958 NG0968 NG0967 NG0965 hesA, - NG0960 NG0964 pncB, - NG0962 syr, - NG0963 nuc, - NG0969 rph,rnpH, - NG0958 NG0968 NG0959 rpiA, - NG0970 NG0965 hesA, - NG0960 NG0964 pncB, - NG0962 syr, - NG0963 NG0961 NG0961 NG0967
* Calculated from Protein Sequence

Gene ID: NG0963

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
syr  

Definition:
arginyl-tRNA synthetase

Gene Start:
936053

Gene Stop:
937768

Gene Length:
1716

Molecular Weight*:
62610

pI*:
5.60

Net Charge*:
-10.15

EC:
6.1.1.19  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Arginine and proline metabolism

Secondary Evidence:
Eriani,G., Dirheimer,G. and Gangloff,J. Isolation and characterization of the gene coding for Escherichia coli arginyl-tRNA synthetase. Nucleic Acids Res. 17 (14): 5725-5736 (1989) [Medline: 89345164].

Comment:
From GenBANK (gi:135169): This protein catalyzes the reaction: ATP + l-arginine + tRNA(arg) = AMP + pyrophosphate + l-arginyl-tRNA(arg). This cytoplasmic monomer belongs to class-I
aminoacyl-tRNA synthetase family.

Oklahoma ID: NGO.963

Blast Summary:  PSI-Blast Search
NG0963 is orthologous to AL162756, N. meningitidis Z2491 arginyl-tRNA synthetase: residues 1-572 have 94% similarity to residues 1-572 in NG0963.

NG0963 also had very strong similarity (P-value < 1e-100) to arginyl-tRNA synthetase proteins in many other organisms; e.g. residues 23-559 are 57% similar to 11271706 of Vibrio cholerae.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0018
COG name: Arginyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0018 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 126-359 are 59% similar to a (SYNTHETASE ARGINYL-TRNA AMINOACYL-TRNA) protein domain (PD002803) which is seen in SYR_ECOLI.

Residues 368-451 are 72% similar to a (SYNTHETASE ARGINYL-TRNA AMINOACYL-TRNA) protein domain (PD186188) which is seen in SYR_ECOLI.

Residues 453-558 are 53% similar to a (SYNTHETASE ARGINYL-TRNA AMINOACYL-TRNA) protein domain (PD186118) which is seen in SYR_ECOLI.

Residues 26-121 are 47% similar to a (SYNTHETASE ARGINYL-TRNA AMINOACYL-TRNA) protein domain (PD003204) which is seen in SYR_HAEIN.



Paralogs:  Local Blast Search


NG0963 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 86 (E-value = 4.1e-35) place NG0963 in the Arg_tRNA_synt_N family which is described as Arginyl tRNA synthetase N terminal domain (PF03485)
Residues 94 to 445 (E-value = 1.4e-137) place NG0963 in the tRNA-synt_1d family which is described as tRNA synthetases class I (R) (PF00750)
Residues 459 to 572 (E-value = 3.1e-47) place NG0963 in the tRNA-synt_1d_C family which is described as DALR anticodon binding domain (PF05746)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
16
non-globular  
240  
313
non-globular  
353  
442

PDB Hit:
pdb|1BS2|1BS2-A YEAST ARGINYL-TRNA SYNTHETASE 221.0 3e-58
pdb|1IQ0|1IQ0-A THERMUS THERMOPHILUS ARGINYL-TRNA SYNTHETASE 160.0 7e-40
pdb|1BS2|1BS2-A YEAST ARGINYL-TRNA SYNTHETASE 651.0 0.000000
pdb|1IQ0|1IQ0-A TH

Gene Protein Sequence:
MNLHQTVEHEAAAAFAAAGIAGSPVVLQPTKNAEHGDFQINGVMGAAKKA
KQNPRELAQKVADALAGNAVIESAEVAGPGFINLRLRHEFLAQNIHAALN
DARFGVAKTAQPQTVVIDYSSPNLAKEMHVGHLRSSIIGDSISRVLEFTG
NTVIRQNHVGDWGTQFGMLVAYLVEQQKDNAAFELADLEQFYRAAKVRFD
EDPAFADTAREYVVKLQGGDETVLALWKQFVDISLSHAQAVYDTLGLKLR
PEDVAGESKYNDDLQPVADDLVQKGLAVEDDGAKVVFLDEFKNKEGEPAA
FIVQKQGGGFLYASTDLACLRYRIGRLKAGRLLYVVDHRQALHFEQLFTT
SRKAGYLPEDAKAEFIGFGTMMGKDGKPFKTRSGDTVKLVDLLTEAVERA
TALVKEKNPELGADEAAKIGKTVGIGAVKYADLSKNRTSDYVFDWDAMLS
FEGNTAPYLQYAYTRVQSVFRKAGEWDATAPTVLTEPLEKQLAAELLKFE
NVLQSVADTAYPHYLAAYLYQAATLFSRFYEACPILKAEGASRNSRLQLA
KLTGNTLKQGLDLLGIDVLDVM

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACCTACATCAAACCGTCGAACACGAAGCCGCCGCCGCCTTTGCCGC
CGCAGGCATCGCCGGCAGCCCCGTTGTCTTGCAGCCGACCAAAAATGCCG
AGCACGGCGATTTCCAAATCAACGGCGTGATGGGTGCGGCGAAAAAAGCC
AAACAAAATCCGCGCGAACTGGCGCAAAAGGTCGCCGACGCATTGGCGGG
CAACGCCGTCATCGAAAGCGCGGAAGTGGCCGGACCCGGCTTTATCAACC
TGCGCCTGCGCCACGAATTTCTCGCTCAAAACATTCATGCGGCTTTGAAC
GATGCGCGTTTCGGCGTAGCGAAAACTGCCCAACCGCAAACCGTCGTCAT
CGACTATTCCTCGCCCAATCTGGCGAAGGAAATGCACGTCGGCCATCTGC
GTTCCAGCATCATCGGCGACAGTATTTCGCGCGTGTTGGAATTTACGGGC
AACACCGTTATCCGTCAAAACCACGTCGGCGACTGGGGTACGCAGTTCGG
CATGTTGGTCGCTTATTTGGTCGAGCAGCAAAAAGACAATGCCGCGTTCG
AGCTGGCGGATTTGGAGCAGTTTTACCGCGCCGCCAAAGTGCGCTTTGAC
GAAGACCCTGCCTTTGCCGACACCGCACGCGAATACGTTGTGAAGCTGCA
AGGCGGCGATGAAACCGTGTTGGCGTTGTGGAAACAGTTTGTCGATATTT
CGCTCTCGCACGCCCAAGCCGTTTACGACACGCTGGGCTTGAAGCTGCGC
CCCGAAGACGTGGCGGGCGAATCGAAATACAACGACGATTTGCAGCCCGT
AGCCGATGATTTGGTTCAAAAAGGCCTGGCGGTTGAGGACGACGGCGCGA
AAGTCGTGTTCTTGGACGAGTTCAAAAACAAAGAGGGCGAACCTGCCGCA
TTTATCGTGCAAAAACAAGGCGGCGGCTTCCTTTATGCTTCCACCGATTT
GGCGTGCCTGCGCTACCGCATAGGCCGTCTGAAAGCCGGCCGCCTGCTGT
ACGTCGTCGACCACCGCCAAGCCCTGCACTTCGAACAACTTTTCACCACT
TCCCGCAAAGCAGGCTATCTGCCTGAAGATGCAAAAGCCGAGTTTATCGG
CTTCGGCACCATGATGGGCAAAGACGGCAAACCGTTCAAAACGCGCAGCG
GCGACACCGTAAAACTGGTTGACCTGCTGACCGAAGCCGTCGAGCGCGCC
ACCGCTTTGGTGAAAGAAAAAAATCCCGAATTGGGCGCGGATGAAGCCGC
CAAAATCGGCAAGACCGTCGGCATCGGCGCAGTCAAATACGCCGACTTGA
GCAAAAACCGCACCAGCGATTATGTGTTCGACTGGGACGCCATGCTCTCA
TTTGAAGGCAACACCGCCCCCTACCTGCAATACGCCTACACCCGCGTGCA
AAGCGTGTTCCGCAAAGCCGGAGAATGGGACGCAACCGCACCGACCGTTT
TGACCGAACCACTGGAAAAACAGCTTGCCGCCGAGCTTCTGAAATTTGAA
AACGTGCTGCAAAGCGTGGCGGACACCGCGTATCCGCACTACCTCGCCGC
CTACCTTTACCAAGCCGCCACCCTGTTCAGCCGCTTCTACGAAGCTTGCC
CGATTTTGAAAGCCGAAGGCGCAAGCCGCAACAGCCGCCTGCAACTGGCA
AAACTCACCGGCAACACGCTGAAACAAGGCTTGGATTTGCTGGGCATCGA
TGTGTTGGACGTAATG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy