Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0790 IGR0795.1 IGR0789 IGR0791 IGR0794 IGR0796 IGR0792 IGR0793 IGR0795 NG0959 rph,rnpH, - NG0958 NG0968 lysC,ak, - NG0956 NG0957 NG0967 NG0965 hesA, - NG0960 NG0964 pncB, - NG0962 syr, - NG0963 NG0959 rph,rnpH, - NG0958 NG0968 lysC,ak, - NG0956 NG0957 NG0967 NG0965 hesA, - NG0960 NG0964 pncB, - NG0962 syr, - NG0963 NG0959 rph,rnpH, - NG0958 NG0968 lysC,ak, - NG0956 NG0957 NG0965 hesA, - NG0960 NG0964 pncB, - NG0962 syr, - NG0963 NG0961 NG0961 NG0967
* Calculated from Protein Sequence

Gene ID: NG0962

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pncB  

Definition:
nicotinate phosphoribosyltransferase

Gene Start:
934702

Gene Stop:
935958

Gene Length:
1257

Molecular Weight*:
48209

pI*:
7.90

Net Charge*:
3.73

EC:
2.4.2.11  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pyridine nucleotides  

Pathway: pathway table
Nicotinate and nicotinamide metabolism

Secondary Evidence:
Vinitsky,A., Teng,H. and Grubmeyer,C.T.
Cloning and nucleic acid sequence of the Salmonella typhimurium pncB gene and structure of nicotinate phosphoribosyltransferase. J. Bacteriol. 173 (2): 536-540 (1991)
[Medline: 91100340].

Wubbolts,M.G., Terpstra,P., van Beilen,J.B., Kingma,J.,
Meesters,H.A. and Witholt,B.
Variation of cofactor levels in Escherichia coli. Sequence analysis and expression of the pncB gene encoding nicotinic acid
phosphoribosyltransferase
J. Biol. Chem. 265 (29), 17665-17672 (1990)
MEDLINE: 91009224


Comment:
For other 'pnc' genes see NG1933 (pncA).


From GenBANK (gi:130367): This protein catalyzes the reaction: nicotinate d-ribonucleotide + pyrophosphate = nicotinate + 5-phospho-alpha-d-ribose 1-diphosphate. This is involved in the first step in preiss-handler pathway leading to the synthesis of NAD. This periplasmic protein requires ATP as well as phosphoribosyl pyrophosphate for activity. It belongs to the NAPRTase family.

Oklahoma ID: NGO.962

Blast Summary:  PSI-Blast Search
NG0962 is orthologous to AL162756, N. meningitidis Z2491 nicotinic acid phosphoribosyltransferase: residues 1-419 have 97% similarity to residues 1-419 in NG0962.

NG0962 also has string similarity (P-value < 1e-80) to nicotinic acid phosphoribosyltransferase proteins in several other organisms; e.g. residues 18-413 are 51% similar to 11258345 of Xylella fastidiosa.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1488
COG name: Nicotinic acid phosphoribosyltransferase
Functional Class:  H
The phylogenetic pattern of COG1488 is a--kyqvcebR---gpol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 222-395 are 30% similar to a (PROTEIN CONSERVED PUTATIVE NICOTINATE) protein domain (PD008895) which is seen in O23191_ARATH.

Residues 15-417 are 43% similar to a (NICOTINATE PHOSPHORIBOSYLTRANSFERASE) protein domain (PD025025) which is seen in PNCB_SALTY.



Paralogs:  Local Blast Search


NG0962 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 23 to 415 (E-value = 2.8e-199) place NG0962 in the NAPRTase family which is described as Nicotinate phosphoribosyltransferase (NAPRTase) family (PF04095)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
130  
146

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MCSNTPQAATRNRETRHMTGIIHSLLDTDLYKFTMLQVVLHQFPQTHSLY
EFRCRNVSTVYPLADIREDLEAELDALCRLRFTHDELGYLRSLRFIKSDF
VDYLELFQLQRRFVEVGTDDKGRLNIRIEGPMIQAMFFEIFILAIVNELY
FRRLETPAVIEEGERRLQAKAARLKEIAAAQNPDEPPFLISDFGTRRRYK
LAWQEHVIRTLLEAAPSIVRGTSNVYLAKKLGITPIGTMAHEFLQAFQAL
DVRLRNFQKAALESWVHEYRGDLGVALTDVVGMDAFLRDFDLYFAKLFDG
LRHDSGDPYVWGDKAYAHYQKLKIDSRTKMLTFSDGLDIERSWALHQYFK
GRFKTGFGIGTNLTNDMGHTPLNIVLKLVECNGQSVAKLSDSPGKTMTNN
STFLAYLRQVFGIPEPRTP

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGTTCTAATACGCCCCAAGCCGCCACCAGAAATCGGGAGACACGCCA
TATGACCGGCATCATACATTCGCTGCTCGACACTGACCTCTACAAATTCA
CTATGCTGCAAGTAGTCCTGCACCAGTTTCCGCAGACGCACAGCCTTTAC
GAATTCCGCTGCCGCAACGTCTCGACCGTCTATCCGCTTGCCGACATCAG
GGAAGACTTGGAAGCCGAACTCGACGCGCTCTGCCGGCTGCGCTTCACCC
ACGACGAACTCGGCTATCTGCGCTCCCTGCGTTTCATCAAAAGCGACTTT
GTCGATTATCTCGAACTCTTCCAGCTCCAACGCCGCTTTGTCGAAGTCGG
CACAGACGATAAAGGCCGTCTGAACATCCGTATCGAAGGCCCGATGATAC
AGGCGATGTTTTTTGAAATCTTCATCCTCGCCATTGTCAACGAACTTTAC
TTCCGCCGGCTGGAAACCCCTGCCGTTATCGAAGAAGGCGAACGCCGGCT
TCAAGCCAAAGCCGCGCGCCTGAAAGAAATCGCCGCCGCACAGAATCCGG
ACGAACCGCCCTTCCTGATTTCCGACTTCGGCACGCGCCGCCGCTACAAG
CTCGCGTGGCAGGAACACGTCATCCGCACCCTGCTCGAAGCCGCCCCAAG
CATCGTGCGCGGCACAAGCAACGTTTACCTCGCCAAAAAACTCGGCATCA
CCCCCATCGGCACCATGGCGCACGAATTCCTCCAAGCCTTCCAAGCCCTC
GACGTGCGCCTGCGGAATTTCCAAAAGGCCGCGCTCGAAAGCTGGGTGCA
CGAATACCGGGGCGATTTGGGCGTTGCCCTGACCGACGTGGTCGGTATGG
ATGCCTTCCTGCGCGATTTCGACCTCTATTTCGCCAAACTCTTTGACGGG
CTGCGCCACGACAGCGGCGACCCTTACGTTTGGGGCGACAAAGCCTACGC
CCACTATCAAAAGCTCAAAATCGACAGCCGCACCAAAATGCTGACCTTCT
CCGACGGGCTGGACATCGAACGCTCTTGGGCATTGCACCAATATTTCAAA
GGCCGCTTCAAAACCGGCTTCGGCATCGGCACCAACCTCACCAACGATAT
GGGGCATACGCCCTTGAATATCGTGTTGAAACTGGTCGAATGCAACGGGC
AGTCCGTCGCCAAGCTCTCCGACTCGCCGGGCAAAACCATGACCAACAAC
AGCACCTTCCTCGCCTACCTGCGCCAAGTGTTCGGCATACCCGAACCTAG
AACGCCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy