Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR0788 IGR0790 IGR0786 IGR0789 IGR0791 IGR0794 IGR0792 IGR0793 IGR0787 NG0955 NG0959 rph,rnpH, - NG0958 lysC,ak, - NG0956 NG0957 NG0953 hesA, - NG0960 pncB, - NG0962 syr, - NG0963 NG0952 NG0955 NG0959 rph,rnpH, - NG0958 lysC,ak, - NG0956 NG0957 NG0953 hesA, - NG0960 pncB, - NG0962 syr, - NG0963 NG0952 NG0955 NG0959 rph,rnpH, - NG0958 lysC,ak, - NG0956 NG0957 NG0953 hesA, - NG0960 pncB, - NG0962 syr, - NG0963 NG0952 NG0961 NG0961
* Calculated from Protein Sequence

Gene ID: NG0958

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rph  rnpH  

Definition:
ribonuclease PH; tRNA nucleotidyltransferase

Gene Start:
932073

Gene Stop:
931348

Gene Length:
726

Molecular Weight*:
25632

pI*:
4.80

Net Charge*:
-7.51

EC:
2.7.7.56  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Secondary Evidence:
MacGregor,C.H., Arora,S.K., Hager,P.W., Dail,M.B. and Phibbs,P.V.Jr. The nucleotide sequence of the Pseudomonas aeruginosa pyrE-crc-rph region and the purification of the crc gene product. J. Bacteriol. 178 (19): 5627-5635 (1996) [Medline: 96421989].

Craven,M.G., Henner,D.J., Alessi,D., Schauer,A.T., Ost,K.A., Deutscher,M.P. and Friedman,D.I. Identification of the rph (RNase PH) gene of Bacillus subtilis: evidence for suppression of cold-sensitive mutations in Escherichia coli. J. Bacteriol. 174 (14): 4727-4735 (1992) [Medline: 92325065].

Comment:
For other 'rnp' genes see NG2181 (rnpA).

From GenBANK (gi:12230959): RNase pH is a phosphorolytic exoribonuclease that removes nucleotide residues following the -CCA terminus of tRNA and adds nucleotides to the ends of RNA molecules by using nucleoside diphosphates as substrates. The reaction: tRNA(n+1) + orthophosphate = tRNA(n) + a nucleoside diphosphate.

Oklahoma ID: NGO.958c

Blast Summary:  PSI-Blast Search
NG0958 is orthologous to AL162756, N. meningitidis ribonuclease PH Z2491: residues 1-242 have 95% similarity to residues 1-242 in NG0958.

NG0958 also has strong hits to rnpH proteins in several other organisms, e.g. residues 7-240 are 57% similar to 12230959 of Pseudomonas aeruginosa.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0689
COG name: RNase PH
Functional Class:  J
The phylogenetic pattern of COG0689 is a-tkYq--ebrh--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002381 (Ribonuclease PH) with a combined E-value of 4.1e-117.
    IPB002381A    5-25
    IPB002381B    50-97
    IPB002381C    99-140
    IPB002381D    177-212


ProDom Summary:  Protein Domain Search
Residues 104-239 are 54% similar to a (NUCLEOTIDYLTRANSFERASE TRANSFERASE POLYRIBONUCLEOTIDE) protein domain (PD002075) which is seen in RNPH_BACSU.

Residues 7-103 are 62% similar to a (RIBONUCLEASE PH RNASE TRNA) protein domain (PD186441) which is seen in RNPH_PSEAE.



Paralogs:  Local Blast Search


NG0958 is paralogously related to NG0335 (polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)) (2e-05).


Pfam Summary:  Pfam Search
Residues 13 to 146 (E-value = 2.6e-50) place NG0958 in the RNase_PH family which is described as 3' exoribonuclease family, domain 1 (PF01138)
Residues 160 to 227 (E-value = 2.4e-14) place NG0958 in the RNase_PH_C family which is described as 3' exoribonuclease family, domain 2 (PF03725)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
64  
207
transmembrane  
132  
148
transmembrane  
162  
178

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPDYIRTSRAADSLRDIKITPHFLPHTDGSCLIECGNTKVICTASVDENA
PPFLHGKNQGWVTAEYGMLPASTALRMRREASAGKQSGRTQEIQRLIGRS
LRAVVDMEKLGERQILIDCDVIQADGGTRTASITGAFVALQIAVGKLVSD
GILSENPILEAVAAVSAGVVNGVPLLDLDYPEDSGCDSDVNIVMTASGKI
IEIQGTAEGAPFSLDELGKLVALAQKGIGELLRYQQNALSVA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTGATTATATCCGCACCTCACGCGCCGCCGACAGCCTGCGCGATAT
CAAAATCACCCCTCATTTCCTGCCGCATACGGACGGTTCGTGCCTTATTG
AATGCGGTAATACCAAAGTGATTTGTACCGCTTCCGTGGACGAAAATGCC
CCACCGTTTCTGCACGGCAAAAACCAAGGCTGGGTAACGGCGGAATACGG
TATGCTGCCTGCCTCAACCGCTTTGCGTATGCGCCGCGAAGCTTCGGCGG
GCAAACAGTCGGGACGCACACAAGAAATCCAACGCTTGATCGGGCGTTCG
CTGCGCGCGGTCGTGGATATGGAAAAACTCGGCGAACGACAAATCCTGAT
TGATTGCGATGTGATTCAGGCGGACGGCGGCACGCGTACGGCTTCGATTA
CCGGTGCGTTTGTCGCGCTGCAAATCGCCGTCGGCAAACTGGTTTCAGAC
GGCATTTTGAGTGAAAACCCCATCCTTGAAGCTGTTGCCGCCGTATCAGC
GGGCGTAGTGAACGGCGTGCCGCTTTTGGATTTGGATTATCCCGAAGACT
CCGGCTGCGACAGTGATGTGAACATCGTCATGACCGCATCGGGGAAAATC
ATCGAAATACAGGGAACGGCGGAAGGCGCGCCATTCAGTTTGGACGAGTT
GGGCAAACTGGTTGCACTGGCGCAAAAAGGCATAGGCGAACTGCTGCGTT
ATCAGCAAAATGCGTTGTCCGTTGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy